KEGG   Gluconacetobacter xylinus: GLX_28100Help
Entry
GLX_28100         CDS       T01631                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
gxy  Gluconacetobacter xylinus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:gxy03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3135330..3136202
Genome map
AA seq 290 aa AA seqDB search
MPELPEVETVMRGMRVHLEGHTISRASTHHTGLRWPFPPGLAASLAGRRVDGFARRGKYI
LITLSGGMVLVMHLGMSGRVLLSTPVEAMPPALHEHLVIETAEGARCGLVDPRRFGMVDL
VTAGAVESHRLLAGMGPEPLGNRFDGAWLAARGKGRRSSIKALLLDQRVVAGLGNIYVSE
ALFRARIHPARAAGAVSGAEYARLATEIRTVLEEAIAAGGSSLRDYVQPDGELGYFQHAW
RVYGREGQGCPDCPGPPACGGVVRITQSGRSTFFCPRQQEMKNARDEDLS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactccctgaagtcgaaactgtgatgcgcgggatgcgagtgcatcttgaaggt
cacactatttcccgcgccagcacgcaccataccgggctgcgctggccgtttccccccggt
ctggctgcaagccttgcgggccgccgcgtggatggattcgcccggcgggggaaatacatc
ctcatcaccctttcgggcggcatggtcctggtcatgcatctgggcatgtcgggacgggtg
ctgctttcgacacctgtggaagcgatgccacccgcccttcacgaacatctggtgatcgag
acggccgagggcgcacgctgcggactggttgacccccgccggttcggtatggtcgatctt
gtaacggcaggtgctgtggaaagtcaccgcctgctggcgggcatgggccctgaaccgctg
ggtaaccgttttgatggcgcatggcttgccgcgcgcggcaaggggcggcgcagcagcatc
aaggcgctcctgctcgaccagcgcgtggtggcgggcctgggcaatatatatgtgtctgag
gcgctgttccgcgcgcgcattcatcccgcgcgcgccgcaggcgcggtgagcggggcggaa
tatgcccgccttgccaccgaaatccgcaccgtgctggaggaggcgatcgccgctggcggc
tcaagcctgcgtgattatgtgcaacccgacggggaattaggctatttccagcatgcgtgg
cgcgtatatgggcgcgaggggcagggctgcccagactgccccggcccgcccgcgtgtggc
ggggtggtgcgcatcacccagtccgggcgctcgactttcttttgcccccgtcagcaggag
atgaaaaacgctcgggatgaagacttgtcttga

DBGET integrated database retrieval system