KEGG   Geobacillus sp. Y412MC52: GYMC52_0039Help
Entry
GYMC52_0039       CDS       T01399                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:gya00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
52116..52988
Genome map
AA seq 290 aa AA seqDB search
MRLSIKAPAKINLSLDVLYKRPDGYHEVKMVMTTIDLADRIELVALPEEDAIRIVSQNRF
VPDDCRNLAYQAAKLLKETFSIRQGVAISITKHIPVAAGLAGGSSDAAATLRGLNKLWQL
GLTLDELAELGAKIGSDVAFCVYGGTALATGRGEIITPIASPPPCWVVLAKPPIGVSTAE
VYRNLELERVSHPDVDAMVRAIERQDYAAICRLVGNVLEEVTLKKYPEVAHIKEQMKRFG
ADAVLMSGSGPTVFGLIEHDSRMQRVYNGLRGFCDQVFAVRLLGERHSLD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgaggttgtcgataaaagcgccggcgaaaatcaatttgtcactcgacgttctttataag
cgcccggatggttaccatgaagtgaaaatggtgatgacgacgatcgatttggccgatcgc
attgagcttgtcgcgttgccggaggaagatgcgatccgcatcgtttcgcaaaaccgcttt
gtgcccgatgattgccgcaacttggcgtatcaggcggcgaagcttcttaaagagacgttt
tcgatccgccaaggggtggccatttcgattacgaagcatattccggtggccgccggattg
gcgggaggaagcagcgatgcggcggcgacgctgcgcgggttgaacaagctttggcagctc
ggattgacgctcgatgaactggcagagcttggggcgaaaatcggttcggatgtcgctttt
tgcgtctacggcggaaccgccttggcgacggggcgcggggaaatcatcactccgatcgct
tcaccgccgccgtgctgggttgtgctggccaagcccccgattggtgtatcgacggcggaa
gtgtaccgaaacttggaacttgagcgtgtcagccatccggatgtcgatgcgatggtgaga
gcgatcgagcggcaagattatgcggcgatctgccggttggtcggcaacgttcttgaggaa
gtgacgttgaaaaaatatccagaagttgcgcatattaaggaacaaatgaagcggtttggc
gctgatgcggtgctgatgagcggcagcgggccgaccgtgtttggactgatcgagcatgat
tcgagaatgcaacgggtgtacaacgggttgcgcggcttttgcgaccaagtatttgcggtg
aggctattgggggaacgccattctcttgattaa

DBGET integrated database retrieval system