KEGG   Geobacillus sp. Y412MC52: GYMC52_0066Help
Entry
GYMC52_0066       CDS       T01399                                 

Definition
anthranilate synthase (EC:4.1.3.27)
Orthology
K01665  
para-aminobenzoate synthetase component I [EC:2.6.1.85]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Folate biosynthesis
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gya00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
80457..81878
Genome map
AA seq 473 aa AA seqDB search
MEQRRRRLKRTIDYRGRDWFRQYEQLAYSRPHHVLLESGQGGRYSIIGLDPIGVIRADER
RLIIKQRGVETVLDGSPLEGLRQWLRCFAVPDEGESLPCQGGLIGFISYDAVRYLERLPV
LAQDDLRLPLMYFFLFDDVAIYDHQTEQLHLLAYANEGEESEANRRLARHARMWLEDRNE
ALVWPLAASTAAPSVSMTKERFMDAVRRVQRYIAAGDVFQVNLSVRQSQPLVTHPFAVYK
QLRMLNPSPYMAYLHTPEFQVVSGSPELLVRKRGWRLETRPIAGTRSRGRTAAEDEQIAR
KLLASEKERAEHAMLVDLERNDLGRVCAYGTVRVDEWMTVEKYSHVMHIVSHVSGTMTTE
HDAFSVIRAMFPGGTITGAPKVRTMEIIEELEPVRRGLYTGSIGWIDFQGNMELNIAIRT
MVVKDGLAHVQAGAGIVIDSNPEHEYKECLKKAAALWKAKELSEAEALFPSTR
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggaacagcggcgcaggcgactgaaacgaactatcgattatcgcggacgggattggttc
cgccagtacgaacagctggcctatagccggcctcatcatgtgttgcttgagagcggccaa
gggggaaggtacagcattatcggccttgacccgatcggagtgatccgcgctgacgagcgg
cggctcatcatcaagcagcgcggggttgaaacggtgctggatggctcgccgctcgaaggg
ctccggcaatggcttcggtgtttcgccgtgccggatgagggggagtcgttgccttgccaa
ggcgggctgatcggtttcattagctatgatgcggttcgctatctggaacggctcccggtg
ctcgcgcaagatgatttgcggctgccgctcatgtattttttcctctttgacgacgtagcg
atttatgatcaccaaactgaacagcttcatttgcttgcctacgcgaatgaaggggaggaa
agcgaagcaaaccggcggcttgcgcggcatgcacggatgtggctcgaggatcggaatgaa
gcgctggtctggccgcttgctgcctcgacagctgcgccgtctgtttcaatgacaaaagag
aggtttatggatgcggttcgccgcgtgcaacgctatattgcggcgggcgatgtgtttcaa
gtcaacttatcggtgcgtcagtcgcagccgctggtgacgcatccatttgccgtctacaag
cagttgcggatgctgaatccgtccccttacatggcgtatttgcataccccggaatttcaa
gtcgtcagcggctcgccggagttgctcgtccgcaagcggggatggcgtcttgagacgcgg
ccgattgccggcacacgttcgcgcggtcggacggcggcagaggatgaacaaattgctcgc
aagttgcttgcgagtgaaaaggagcgggccgagcacgccatgctcgttgatcttgaacgg
aatgaccttgggcgcgtctgtgcatacgggacggttcgagttgacgaatggatgaccgtc
gaaaagtattctcatgtgatgcatatcgtttctcacgtatccggcaccatgacgacggag
cacgatgcgttttccgtcattcgcgccatgtttcccggcgggacgatcaccggcgctccg
aaagtgcgaacaatggaaattattgaagagttggaaccggtccgccgcggcttgtacacg
ggctcgatcggttggatcgattttcaaggaaacatggagctaaacatcgccattcgaacg
atggtcgtcaaagacggattggcgcatgtacaggcaggagcgggcatcgtcatcgattcc
aacccagagcatgagtacaaggaatgtttaaagaaagcggctgccctttggaaagcgaaa
gagctgagcgaagcagaggcattatttccgagcacgaggtga

DBGET integrated database retrieval system