KEGG   Geobacillus sp. Y412MC52: GYMC52_0085Help
Entry
GYMC52_0085       CDS       T01399                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:gya00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    GYMC52_0085
Enzymes [BR:gya01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     GYMC52_0085
Amino acid related enzymes [BR:gya01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   GYMC52_0085
Transfer RNA biogenesis [BR:gya03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    GYMC52_0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
106152..107627
Genome map
AA seq 491 aa AA seqDB search
MMAKEVRVRYAPSPTGHLHIGGARTALFNYLFARHHGGKMIVRIEDTDIERNVEGGEKSQ
LENLKWLGIDYDESIDQDGGYGPYRQTERLDIYRKYVNELLEQGHAYKCFCTPEELERER
EAQRAAGIAAPQYSGKCRHLTPEQVAELEAQGKPYTIRLKVPEGKTYEFYDLVRGKVVFE
SKDVGGDWVIVKANGIPTYNFAVVIDDHLMEISHVFRGEEHLSNTPKQLMVYEYFGWEPP
QFAHLTLIVNEQRKKLSKRDESIIQFVSQYKELGYLPEAMFNFFALLGWSPEGEEEIFTK
DELIRMFDVSRLSKSPSMFDTKKLTWMNNQYIKKLDLDRLVELALPHLVKAGRLPADMTD
EQRQWARDLIALYQEQMSYGAEIVPLSELFFKEEIDYEDEARQVLAEEQVPAVLSTFLES
VRELEPFTADEIKAAIKAVQKATGQKGKKLFMPIRAAVTGQTHGPELPFAIQLLGKEKVI
ERLERALQEKF
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaaagaggtgcgcgtgcgctatgcgccgagcccaaccggccatttgcatatc
ggcggggcgcggacagcgctgtttaactatttgtttgcccgccatcacggtggaaaaatg
atcgtccgcatcgaggatacggatattgaacggaacgtcgaaggtggcgaaaagtcgcag
ctcgaaaacttaaaatggctcggcattgattatgatgaatcgattgatcaagatggcggc
tacgggccgtaccggcaaacggagcggctcgatatttaccgaaaatatgtgaatgaattg
cttgagcaagggcatgcgtacaaatgtttttgcacgccggaagagctcgagcgcgagcgg
gaggcgcagcgggcggccggcatcgccgctccgcagtacagcggcaaatgccgccatttg
acgccggagcaggtcgcggagctcgaggcgcaagggaagccgtatacgatccgcctgaag
gtgccggaagggaaaacgtacgagttttacgatttagtgcgcggcaaagtggtgtttgaa
tcgaaagatgtcggcggcgattgggtgattgtcaaggcgaatggcattccgacatacaat
ttcgctgttgtcatagacgaccatttaatggaaatcagccatgtgtttcgcggtgaggaa
catttgtccaatacgccgaagcagctcatggtatacgagtatttcggctgggagccgccg
cagttcgcgcacttgacgttgatcgtcaacgagcagcggaaaaagctgtctaagcgcgat
gaatcaatcattcagttcgtctcgcaatacaaagaacttggctatttgccggaagcgatg
ttcaactttttcgctttgcttggctggtcgccggaaggagaggaagaaatttttacgaaa
gacgaactgatccgcatgttcgatgtctcccggctgtcaaaatcgccgtccatgtttgat
acgaaaaagctgacatggatgaacaaccaatatatcaaaaagcttgatcttgaccggctt
gtcgagctggccttgccgcatttagtgaaagccgggcgcctgccggcggatatgacggac
gaacagcggcaatgggcgcgcgatttaattgctttgtatcaagagcaaatgagctacggg
gcggagatcgtcccgctgtctgagctgttctttaaagaagaaatcgactacgaggacgag
gcgcgtcaagtgcttgctgaagagcaagtgccggctgtgctttccaccttccttgagagc
gtgcgtgagcttgagccgtttacggcagacgagattaaagcggccattaaagcggtgcaa
aaggcgaccgggcaaaaagggaaaaagttgtttatgccgatccgcgcggcggtgacggga
caaacgcacggaccggagctgccgtttgccattcagttgctcggcaaagaaaaagtgatc
gagcggctggagcgggcgttgcaagaaaaattttaa

DBGET integrated database retrieval system