KEGG   Geobacillus sp. Y412MC52: GYMC52_0603Help
Entry
GYMC52_0603       CDS       T01399                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYMC52_0603
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GYMC52_0603
Enzymes [BR:gya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     GYMC52_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
645276..646562
Genome map
AA seq 428 aa AA seqDB search
MASFAERVRQLEESWKNEERWEGIVRPYSAEDVIKLRGSLDIEYTLARRGAEKLWKLLHT
EDYVAALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPSNSVPHVVK
RINQALQRADQIQYLEGSGDVDYFVPIVADAEAGFGGQLNVFELMKAMIEAGAAGVHFED
QLSSEKKCGHLGGKVLLPTQTAIRNLIAARLAADVMGVPTVLIARTDANAADLITSDIDP
RDQAFITGERTPEGFYRTRAGLDQAIARGLAYAPYADLIWCETSEPNLDEARRFAEAIHE
KFPGKLLAYNCSPSFNWKKKLDDETIAKFQQELGKMGYKFQFVTLAGFHALNYSMFELAR
GYKERGMAAYAELQQAEFAAEKYGYTATRHQREVGTGYFDEVAQVISGGQSSTVALKGST
EEEQFTTA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcatttgctgaacgtgtccggcaattagaagaaagttggaaaaacgaggagcgc
tgggaagggatcgtccgtccgtacagcgcggaggatgtcattaaactgcgcggctcgctt
gacatcgagtatacgctcgctcgacgcggggcggaaaaattatggaagctgcttcataca
gaggattacgtcgcggcccttggcgcgctgaccggaaatcaggcggtgcagcaagtgaaa
gcaggcttgaaggcgatttatttaagcggctggcaagtggcggccgacgccaacctcgct
ggacagatgtatccggaccaaagcctgtatccgtccaacagcgttccgcatgtcgtcaag
cgaatcaatcaagcgttgcagcgcgcggatcaaattcaatacttagaaggcagcggggac
gtggactactttgtgccgatcgtcgctgacgccgaggcgggattcggcggccaactgaac
gtctttgagctcatgaaggcgatgattgaggccggagcggctggcgtccattttgaagac
cagctgtcatcggagaaaaaatgcggccatttaggcggcaaagtgcttttgccgacgcaa
acggcgattcgcaacttgatcgcggcgcggttggccgccgatgtcatgggggttccgacg
gtgctcatcgcacgcaccgacgcgaacgctgctgacttgatcacaagcgacatcgacccg
cgcgatcaagcgtttatcaccggggaacggactccggaagggttttatcgcacaagagcc
ggtttggatcaagcgatcgcccgcgggcttgcctatgcgccatatgccgacctcatttgg
tgcgagacgagcgagccgaatttggatgaggcgcgccgatttgccgaagccatccatgag
aaattcccaggcaagctgctggcgtacaactgctcgccgtcgttcaactggaagaaaaaa
ttggacgacgaaacgatcgccaaattccagcaagagctcggcaaaatgggatacaagttc
caatttgtcaccttggctggcttccatgcgctcaactacagcatgttcgaactggcgcgc
ggctacaaagagcgaggcatggcggcgtacgccgagctgcagcaagcggaatttgccgcc
gagaagtacggctacacggcgacgcgccatcagcgcgaagtcggcacgggctatttcgac
gaagtcgcccaagtgatctctggcggccaatcgtcaacagtcgctttgaaaggatcgacc
gaagaagaacagtttacgacagcttaa

DBGET integrated database retrieval system