KEGG   Geobacillus sp. Y412MC52: GYMC52_0607Help
Entry
GYMC52_0607       CDS       T01399                                 

Definition
signal peptidase I (EC:3.4.21.89)
Orthology
K03100  
signal peptidase I [EC:3.4.21.89]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Protein export
Brite
KEGG Orthology (KO) [BR:gya00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    GYMC52_0607
Enzymes [BR:gya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     GYMC52_0607
Peptidases [BR:gya01002]
 Serine Peptidases
  Family S26: signal peptidase I family
   GYMC52_0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
648240..648788
Genome map
AA seq 182 aa AA seqDB search
MTKQKEKRGRRWPWFVAVCVVATLRLFVFSNYMVEGKSMMPTLESGNLLIVNKLSYDIGP
IRRFDIIVFHANKKEDYVKRVIGLPGDRIAYKNDILYVNGKKVDEPYLRPYKQKLLDGRL
TGDFTLEEVTGKTRVPPGCIFVLGDNRLSSWDSRHFGFVKINQIVGKVDFRYWPFKQFAF
QF
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagcaaaaagaaaaacgaggccgccgatggccatggtttgttgccgtttgtgtt
gtcgccacgcttcggttgttcgtgttcagcaattacatggtggaaggaaaatcgatgatg
ccgacgctagagagcggcaatttgctgatcgtcaataagctttcctacgacatcgggcct
attcgccggttcgacattatcgtttttcacgccaacaaaaaggaagattacgtcaagcgg
gttatcggcctgcctggcgatcggatcgcgtacaaaaatgacatcttgtatgtcaacgga
aaaaaagttgacgaaccgtatttgcgcccgtataagcaaaagctgcttgacggcaggctg
accggggattttacgcttgaggaggtgaccgggaaaacacgggtgcctcccggctgcatt
ttcgttcttggcgacaaccggcttagcagctgggacagccgccattttgggtttgtcaaa
atcaaccaaattgtcggcaaggtggactttcgctactggccgtttaaacagttcgccttt
cagttttaa

DBGET integrated database retrieval system