KEGG   Geobacillus sp. Y412MC52: GYMC52_0607Help
Entry
GYMC52_0607       CDS       T01399                                 

Definition
signal peptidase I (EC:3.4.21.89)
Orthology
K03100  
signal peptidase I [EC:3.4.21.89]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Protein export
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:gya03060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
648240..648788
Genome map
AA seq 182 aa AA seqDB search
MTKQKEKRGRRWPWFVAVCVVATLRLFVFSNYMVEGKSMMPTLESGNLLIVNKLSYDIGP
IRRFDIIVFHANKKEDYVKRVIGLPGDRIAYKNDILYVNGKKVDEPYLRPYKQKLLDGRL
TGDFTLEEVTGKTRVPPGCIFVLGDNRLSSWDSRHFGFVKINQIVGKVDFRYWPFKQFAF
QF
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagcaaaaagaaaaacgaggccgccgatggccatggtttgttgccgtttgtgtt
gtcgccacgcttcggttgttcgtgttcagcaattacatggtggaaggaaaatcgatgatg
ccgacgctagagagcggcaatttgctgatcgtcaataagctttcctacgacatcgggcct
attcgccggttcgacattatcgtttttcacgccaacaaaaaggaagattacgtcaagcgg
gttatcggcctgcctggcgatcggatcgcgtacaaaaatgacatcttgtatgtcaacgga
aaaaaagttgacgaaccgtatttgcgcccgtataagcaaaagctgcttgacggcaggctg
accggggattttacgcttgaggaggtgaccgggaaaacacgggtgcctcccggctgcatt
ttcgttcttggcgacaaccggcttagcagctgggacagccgccattttgggtttgtcaaa
atcaaccaaattgtcggcaaggtggactttcgctactggccgtttaaacagttcgccttt
cagttttaa

DBGET integrated database retrieval system