KEGG   Geobacillus sp. Y412MC52: GYMC52_0628Help
Entry
GYMC52_0628       CDS       T01399                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gya00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
673917..675764
Genome map
AA seq 615 aa AA seqDB search
MCGITGWVHFGRNLRRERTVIDSMTETLAKRGPDDTNTWLDTHVAFGHKRLVVVDPAGGK
QPMVRQKNGHRYTIVYNGELYNTEDIRKELLRQGYRFDGHSDTEVLLAAYMEWKEKCVDW
LNGIFAFAVWDEERELLFMARDRLGVKPLFYREDGEGLLFGSEVKAILAHPDVKAEVNYE
GLAEVFGLGPSRTPGHGVFDGIRELRPAHALTFSRSGLRIWRYWNVESDVHRDSFEETVE
KLRFLLTDAVTRQLVSDVPVCTFLSGGVDSSAITGIAANAFAADGKGPLHTYSIDYEGND
QYFKANDFQPNTDAPFIEQVSNQFQTVHHRCVITQEELFRHLHEAVIVRDVPGMADVDSS
LLWFCKQIRERFVVSLSGECADEIFGGYPWFHRPDDLSRKGFPWMRSVDARMGLLKDEWR
QKLRLDDYVQMRYEQTLAEVPRLEGESAEEAKRRELFYLNMIWFMTTLLDRKDRMSMGAS
LEVRVPFADHRIVEYVWNIPWDMKMYGGREKGLLRKALEGLLPEEVLYRKKSPYPKTHHP
LYTKLVKQWLEQLLHDRSSVLHEFFDREKLLALIETEGKSFQVPWFGQLMTGPQLLAYLG
QVHVWFDHYGIRIKE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcattactggctgggtccatttcgggcgcaatttgcgccgcgagcggacggtc
attgacagcatgacagagacgctcgccaaacgtggaccagatgatacaaatacgtggctg
gacactcatgtcgccttcggccataaacggcttgtcgtcgtggatccggctggcggcaaa
caaccgatggtccggcaaaaaaacggacatcgttatacgatcgtctataacggcgagctg
tataatacggaagacattcgcaaggaactgttgcgccaaggctatcgatttgatggtcat
tccgatacagaagtgttgcttgccgcatatatggaatggaaggagaaatgcgtcgattgg
ctcaacggcatttttgccttcgccgtttgggacgaggagcgcgagctgttatttatggcg
cgcgaccggctcggagtaaaacctttgttttatcgagaagatggcgaggggctgctgttc
ggctcggaagtgaaagccattttggcccatcccgatgtaaaggcagaagtcaattatgaa
ggactcgccgaagtgttcggcctcggaccgtcgcgcacaccggggcacggcgtgtttgac
ggcattcgagagctgcgcccggcacatgcgctcacgttctctcgcagcgggcttcgcatt
tggcggtattggaatgtcgaaagcgacgtccaccgcgattcgttcgaggaaacggtcgaa
aagctgcgctttctattgacggatgcggtcacgcgccaactcgtttccgatgtgccggtc
tgcacatttctatccggtggagtcgattcaagcgccattacagggattgccgccaatgcc
ttcgcggcagatggaaaagggccgctgcacacctactcgatcgattatgaaggaaacgac
cagtatttcaaagccaacgattttcaaccaaacacggatgcgccatttatcgaacaggtg
tcaaaccaatttcaaacggttcatcatcgctgcgtgatcacgcaagaagaactgttccgc
catttgcatgaagccgtcatcgtccgcgacgttccgggcatggccgatgtcgattcttcg
cttctttggttttgcaaacaaattcgcgaacggtttgtcgtcagcttatctggggagtgc
gccgatgaaattttcggcggctatccatggtttcatcggccggacgatttgtctcggaaa
ggatttccgtggatgcgttcggtcgacgcgcgcatgggcctattaaaggatgagtggcgg
caaaagcttcgccttgacgactatgtgcaaatgcgttatgaacaaacgcttgctgaagtg
ccgcgtctcgagggggaaagcgccgaggaggcgaagcggcgtgagctgttttacttaaat
atgatttggtttatgacgacactgcttgaccgaaaagaccggatgagcatgggagcaagc
ttggaagtgcgtgtgccgttcgctgaccatcgcattgtcgaatacgtttggaacattccg
tgggatatgaaaatgtacggcggccgagaaaaaggccttttgcgaaaagcgctcgaggga
ttgcttcccgaagaggtgctctaccggaaaaaaagcccatatccgaaaacgcaccatcct
ctatatacgaaacttgtcaagcaatggcttgagcagttgctccatgatcgctcttcggtt
ttgcacgagtttttcgaccgggaaaaattgctggcgctcattgaaacagaagggaagtcg
ttccaagtgccgtggtttgggcagctcatgaccggtccgcagctgctcgcttaccttggc
caagtgcacgtttggtttgatcattacggcattcgcattaaagaataa

DBGET integrated database retrieval system