KEGG   Geobacillus sp. Y412MC52: GYMC52_0757Help
Entry
GYMC52_0757       CDS       T01399                                 

Definition
bis(5'-nucleosyl)-tetraphosphatase (EC:3.6.1.17)
Orthology
K01090  
protein phosphatase [EC:3.1.3.16]
Organism
gya  Geobacillus sp. Y412MC52
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(799037..799774)
Genome map
AA seq 245 aa AA seqDB search
MQVDIIGDIHGCFREFAALTETLGYHWDEGVPIHPDGRKLGFVGDLTDRGPESLNMIEIV
CALVERNLAYYVPGNHCNKLYRFFLGRNVQIAHGLETTVAEYRSLPPSEQEMIRRKFIRL
YEQAPLYAVLDEGRLVIAHAGIRHDYIGRTDKKVKTFVLYGDITGETNPDGTPVRRDWAK
RYHGSAWVVYGHTPVEKPRFVGRTVNIDTGCVFGGALTALRYPEMETVSVPSSMPFVPEK
FRTFS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtggacatcatcggcgacattcatggctgcttccgcgaattcgccgcattgacg
gaaacactcggctaccattgggacgaaggggtgccgattcatcccgacggacgaaagctc
ggcttcgtcggcgatttgaccgaccgcggtcctgaatcgctgaacatgatcgagatcgtc
tgcgcccttgttgagcgaaatttggcttactacgtgccaggcaaccattgcaataaactg
taccgcttttttttaggacgaaacgtgcaaatcgcccacgggcttgagacgaccgtcgcc
gagtaccgctccttgcctccaagcgaacaggagatgatccgccgcaagttcatccgcctg
tatgaacaggcgccgctgtatgcggtgctcgatgaggggcgccttgtcatcgcccacgcc
ggcatccgtcacgactatatcgggcggacggacaaaaaagtcaagacgttcgtcctgtat
ggggacatcaccggcgaaacgaacccggacgggacgccggtgcgccgcgactgggcgaaa
cggtatcacggcagcgcatgggttgtatatggccacacgccggtcgaaaaaccgcggttt
gtcgggcggacggtcaacatcgacaccggctgcgtattcggcggcgcgctgaccgccttg
cgctatccggaaatggaaacagtctccgttccttcctcgatgccgttcgttccggaaaaa
ttccgcacgttctcctaa

DBGET integrated database retrieval system