KEGG   Geobacillus sp. Y412MC52: GYMC52_0874Help
Entry
GYMC52_0874       CDS       T01399                                 

Definition
acireductone dioxygenase (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GYMC52_0874
Enzymes [BR:gya01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     GYMC52_0874
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     GYMC52_0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
912684..913226
Genome map
AA seq 180 aa AA seqDB search
MAVIKVRKTGQVIEGEDNVRAFLNSQGVLYEHWDITKLPEHLRDKYVLTDEEKNEILAAF
KDEIEDLAARRGYKTWDIVALSDATPNLDELLKKFEQVHIHTEDEVRAITAGHGIFIIKG
DKETGYFDVELEAGDVISVPEGNPHYFTLMDDRRVVAVRLFIDPSGWVAHPYEEKEEAVQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcatcaaagtgagaaaaacgggtcaagtgattgaaggagaagacaatgtgcgc
gcgtttttgaacagtcaaggggtgttgtatgaacattgggacatcacgaaactgccggag
catttgcgtgacaaatacgtactcacggatgaagaaaaaaatgaaattttagcggcgttc
aaagatgaaattgaagatttggcggcgcgccgcggctacaaaacgtgggatatcgtcgct
ctgtccgacgcgacgccgaacttggatgaactgctgaaaaaatttgaacaagtgcacatc
catacggaagatgaagtgcgcgccattacggccggccatggcattttcatcatcaaaggc
gacaaagaaaccggctattttgatgtagagcttgaagccggcgacgtcatttccgtgccg
gaagggaatccgcattactttacgctcatggatgaccgtcgggtcgttgcggtgcgcttg
tttatcgacccgtccggctgggtcgctcatccatatgaagaaaaagaggaagccgtccaa
taa

DBGET integrated database retrieval system