KEGG   Geobacillus sp. Y412MC52: GYMC52_0874Help
Entry
GYMC52_0874       CDS       T01399                                 

Definition
acireductone dioxygenase (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:gya00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
912684..913226
Genome map
AA seq 180 aa AA seqDB search
MAVIKVRKTGQVIEGEDNVRAFLNSQGVLYEHWDITKLPEHLRDKYVLTDEEKNEILAAF
KDEIEDLAARRGYKTWDIVALSDATPNLDELLKKFEQVHIHTEDEVRAITAGHGIFIIKG
DKETGYFDVELEAGDVISVPEGNPHYFTLMDDRRVVAVRLFIDPSGWVAHPYEEKEEAVQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcatcaaagtgagaaaaacgggtcaagtgattgaaggagaagacaatgtgcgc
gcgtttttgaacagtcaaggggtgttgtatgaacattgggacatcacgaaactgccggag
catttgcgtgacaaatacgtactcacggatgaagaaaaaaatgaaattttagcggcgttc
aaagatgaaattgaagatttggcggcgcgccgcggctacaaaacgtgggatatcgtcgct
ctgtccgacgcgacgccgaacttggatgaactgctgaaaaaatttgaacaagtgcacatc
catacggaagatgaagtgcgcgccattacggccggccatggcattttcatcatcaaaggc
gacaaagaaaccggctattttgatgtagagcttgaagccggcgacgtcatttccgtgccg
gaagggaatccgcattactttacgctcatggatgaccgtcgggtcgttgcggtgcgcttg
tttatcgacccgtccggctgggtcgctcatccatatgaagaaaaagaggaagccgtccaa
taa

DBGET integrated database retrieval system