KEGG   Geobacillus sp. Y412MC52: GYMC52_0874Help
Entry
GYMC52_0874       CDS       T01399                                 

Definition
(GenBank) Acireductone dioxygenase (Fe(2+)-requiring)
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00270  Cysteine and methionine metabolism
gya01100  Metabolic pathways
Module
gya_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GYMC52_0874
Enzymes [BR:gya01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     GYMC52_0874
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     GYMC52_0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding Inhibitor_I66 Cupin_6 Intein_splicing
Motif
Other DBs
NCBI-ProteinID: ADU93350
JGI: GYMC52_0874
UniProt: A0A0E0T9I4
Position
912684..913226
Genome map
AA seq 180 aa AA seqDB search
MAVIKVRKTGQVIEGEDNVRAFLNSQGVLYEHWDITKLPEHLRDKYVLTDEEKNEILAAF
KDEIEDLAARRGYKTWDIVALSDATPNLDELLKKFEQVHIHTEDEVRAITAGHGIFIIKG
DKETGYFDVELEAGDVISVPEGNPHYFTLMDDRRVVAVRLFIDPSGWVAHPYEEKEEAVQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcatcaaagtgagaaaaacgggtcaagtgattgaaggagaagacaatgtgcgc
gcgtttttgaacagtcaaggggtgttgtatgaacattgggacatcacgaaactgccggag
catttgcgtgacaaatacgtactcacggatgaagaaaaaaatgaaattttagcggcgttc
aaagatgaaattgaagatttggcggcgcgccgcggctacaaaacgtgggatatcgtcgct
ctgtccgacgcgacgccgaacttggatgaactgctgaaaaaatttgaacaagtgcacatc
catacggaagatgaagtgcgcgccattacggccggccatggcattttcatcatcaaaggc
gacaaagaaaccggctattttgatgtagagcttgaagccggcgacgtcatttccgtgccg
gaagggaatccgcattactttacgctcatggatgaccgtcgggtcgttgcggtgcgcttg
tttatcgacccgtccggctgggtcgctcatccatatgaagaaaaagaggaagccgtccaa
taa

DBGET integrated database retrieval system