KEGG   Geobacillus sp. Y412MC52: GYMC52_0924Help
Entry
GYMC52_0924       CDS       T01399                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYMC52_0924
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GYMC52_0924
  Amino acid metabolism
   00310 Lysine degradation
    GYMC52_0924
Enzymes [BR:gya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GYMC52_0924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
962848..964116
Genome map
AA seq 422 aa AA seqDB search
MAEIKVPELAESITEGTIAQWLKKPGDYVEKGESICELETDKVNVEIMAEESGVLQQLLA
NEGDTVAVGQAIAIIGEGAAAPTAALQAAPQPADETETVAPADSNEQPAPQPVAVAQAPS
QRPIASPAARKMAREKGIDLTQVPTVDPLGRVRKQDVASFAAQPAAAPQPAPQAAPTSTP
AAVPAAEAGKPVIREKMSRRRQTIAKRLLEVTQTTAMLTTFNEIDMSAVIDLRKRKKDKF
FEEHDVRLGFMSFFVKAAVAALKKYPYVNAEIQGDEILLKKYYDIGVAVSTDEGLVVPVV
RDCDRKNFAEIERDIAELAAKARSNKLSLADLQGGTFTITNGGVFGSLLSTPLLNGPQVG
ILGMHSIKLRPVAVDEERIENRPMMYVALSYDHRIIDGKEAVGFLKTVKDLIENPEDLLL
ES
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagatcaaagtcccagagttagcagaatccatcacggagggaacgatcgcccaa
tggctgaaaaaaccgggcgactacgtggaaaaaggagaatcgatttgcgagcttgaaacg
gataaagtgaacgtggaaattatggcggaagagtcgggtgttttgcaacagctgcttgcc
aatgaaggcgatacggttgcggttggccaagcgatcgccattatcggcgaaggagcggca
gcaccgactgccgctttgcaagctgctccgcagccagccgatgaaacggaaacggtcgcg
ccggccgacagcaatgaacagccagcgccgcagccagtcgcggttgcccaggcgccgagc
cagcggccaatcgcctctccggctgcccggaaaatggcgcgtgaaaaagggatcgacttg
acgcaagtgccgaccgttgatccgcttgggcgcgtgcgcaaacaagacgtcgcttcgttt
gccgcacaaccggccgccgccccgcagccggctccgcaagccgcgccgacgtcgacgccg
gccgccgttccagccgctgaggccggcaagccggtcatccgcgaaaaaatgtcgcgccgt
cggcaaacgatcgccaaacggctgcttgaagtgacgcaaacgaccgcgatgttgacgacg
ttcaacgaaattgacatgtcggcggtcatcgatctgcgcaagcggaaaaaagataaattt
ttcgaagagcatgacgtccgcctcggctttatgtcatttttcgtcaaagcggctgtcgcg
gcgctgaaaaaatatccgtacgtcaacgcggaaattcaaggcgatgaaattttgttgaaa
aaatattatgatatcggcgtcgccgtgtcgacggacgaagggcttgtcgttccggttgtg
cgcgactgcgaccggaaaaacttcgctgaaattgagcgcgacattgccgaattggcggcg
aaagcgcgcagcaataagttgtcgcttgccgatttgcaaggcggcacgtttacgatcacc
aacggcggcgtgttcggttcactgttgtcgactccgcttctcaacgggccgcaagtcggc
attttagggatgcattcgatcaaactgcgtccggtcgccgtcgatgaagagcggatcgaa
aaccgtcccatgatgtacgtcgccttgtcatacgaccaccgcatcatcgatggcaaagag
gccgtagggttcttaaaaacggtgaaagacttgatcgaaaatccggaagatttgctgctt
gaaagctga

DBGET integrated database retrieval system