KEGG   Geobacillus sp. Y412MC52: GYMC52_0924Help
Entry
GYMC52_0924       CDS       T01399                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gya01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:gya00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:gya00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
962848..964116
Genome map
AA seq 422 aa AA seqDB search
MAEIKVPELAESITEGTIAQWLKKPGDYVEKGESICELETDKVNVEIMAEESGVLQQLLA
NEGDTVAVGQAIAIIGEGAAAPTAALQAAPQPADETETVAPADSNEQPAPQPVAVAQAPS
QRPIASPAARKMAREKGIDLTQVPTVDPLGRVRKQDVASFAAQPAAAPQPAPQAAPTSTP
AAVPAAEAGKPVIREKMSRRRQTIAKRLLEVTQTTAMLTTFNEIDMSAVIDLRKRKKDKF
FEEHDVRLGFMSFFVKAAVAALKKYPYVNAEIQGDEILLKKYYDIGVAVSTDEGLVVPVV
RDCDRKNFAEIERDIAELAAKARSNKLSLADLQGGTFTITNGGVFGSLLSTPLLNGPQVG
ILGMHSIKLRPVAVDEERIENRPMMYVALSYDHRIIDGKEAVGFLKTVKDLIENPEDLLL
ES
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagatcaaagtcccagagttagcagaatccatcacggagggaacgatcgcccaa
tggctgaaaaaaccgggcgactacgtggaaaaaggagaatcgatttgcgagcttgaaacg
gataaagtgaacgtggaaattatggcggaagagtcgggtgttttgcaacagctgcttgcc
aatgaaggcgatacggttgcggttggccaagcgatcgccattatcggcgaaggagcggca
gcaccgactgccgctttgcaagctgctccgcagccagccgatgaaacggaaacggtcgcg
ccggccgacagcaatgaacagccagcgccgcagccagtcgcggttgcccaggcgccgagc
cagcggccaatcgcctctccggctgcccggaaaatggcgcgtgaaaaagggatcgacttg
acgcaagtgccgaccgttgatccgcttgggcgcgtgcgcaaacaagacgtcgcttcgttt
gccgcacaaccggccgccgccccgcagccggctccgcaagccgcgccgacgtcgacgccg
gccgccgttccagccgctgaggccggcaagccggtcatccgcgaaaaaatgtcgcgccgt
cggcaaacgatcgccaaacggctgcttgaagtgacgcaaacgaccgcgatgttgacgacg
ttcaacgaaattgacatgtcggcggtcatcgatctgcgcaagcggaaaaaagataaattt
ttcgaagagcatgacgtccgcctcggctttatgtcatttttcgtcaaagcggctgtcgcg
gcgctgaaaaaatatccgtacgtcaacgcggaaattcaaggcgatgaaattttgttgaaa
aaatattatgatatcggcgtcgccgtgtcgacggacgaagggcttgtcgttccggttgtg
cgcgactgcgaccggaaaaacttcgctgaaattgagcgcgacattgccgaattggcggcg
aaagcgcgcagcaataagttgtcgcttgccgatttgcaaggcggcacgtttacgatcacc
aacggcggcgtgttcggttcactgttgtcgactccgcttctcaacgggccgcaagtcggc
attttagggatgcattcgatcaaactgcgtccggtcgccgtcgatgaagagcggatcgaa
aaccgtcccatgatgtacgtcgccttgtcatacgaccaccgcatcatcgatggcaaagag
gccgtagggttcttaaaaacggtgaaagacttgatcgaaaatccggaagatttgctgctt
gaaagctga

DBGET integrated database retrieval system