KEGG   Geobacillus sp. Y412MC52: GYMC52_1015Help
Entry
GYMC52_1015       CDS       T01399                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    GYMC52_1015
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GYMC52_1015
Enzymes [BR:gya01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     GYMC52_1015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1048634..1050103
Genome map
AA seq 489 aa AA seqDB search
MKLLTLLSHLPGFWVHHGGNPDIVALEMDSRRVAPGSLFFCLKGFTVDGHDFAEEAVARG
AAAIVAERPLSVDVPVVLVSDSRRAMAILADAFYGRPTHRLHLIGVTGTNGKTTTTSIME
QIARKAGKKTGLIGTVHIKVGDRSYPAANTTPESLILQRTFKQMVDEGVEFVAMEVSSHA
LHQGRVHGCDYDVAVFTNLTQDHLDYHGTMEEYRNAKGLLFAQLGNRYDERRPKFAVLNH
DDPVSQYYKHMTAAPIVTYGMREKSDVMAEQIRITAGGMAFRLCTPHGSAAVETKLVGSF
NVYNILAAAAACLASGFSLETIAAALADVEPVPGRFETVDEGQNFTIIVDYAHTPDSLEN
ALKTVRQLAKRNVYVVIGCGGDRDRSKRPLMAQVAVRYADVAIFTSDNPRSEDPKQILRD
MEAGVSAEIGKHVTIPDREEAIRYAIGQAQEGDVVLIAGKGHETYQIIGNDVIEFDDRAV
ARAAVKERG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgctgacgctgctgtcacacttgcccggtttttgggtgcaccatggaggcaat
cccgatatcgtggcgctcgaaatggactcgcgccgcgttgcccccggttctctctttttt
tgccttaaagggtttacagtagacggacacgactttgccgaggaagcggtggcgcgcgga
gcggcggcgatcgtggccgagcgaccgctttccgttgatgttccggtcgttcttgtgtcg
gacagccggcgggcgatggcgattttagcggacgcgttttacgggcggccgacccaccgc
cttcatttaatcggagtgacaggcacaaacggcaagacgacgacaacgtcgatcatggaa
caaatcgcgagaaaagccggcaagaaaacagggctcattggcacggttcacatcaaggtc
ggcgaccgctcctatccggcggccaatacgacgccggagtcgctcattttgcagcgcacg
tttaaacagatggtcgatgaaggagtggagtttgtcgccatggaagtgtcgtcgcacgcg
ctgcaccaagggcgggtgcatggctgcgattacgatgtggccgtctttacgaacttaacg
caagaccatttggattatcacgggacaatggaagaatatcggaacgccaaagggcttttg
tttgcccagctcggcaaccgctacgacgaacggcggccgaaatttgccgttctcaatcat
gacgatccggtttcgcagtattataaacatatgacggccgcgccgatcgtcacatacggg
atgagggaaaaaagcgatgtgatggcggaacagatccgcataaccgcaggcggcatggcg
tttcggctttgcacgccgcacggatcggcggcggtcgaaacgaaacttgtcggctcgttc
aatgtctataacattctcgccgctgccgctgcctgccttgcctctggcttttcgcttgaa
acgatcgccgcggcgcttgcggatgtcgagccggtgccggggcggtttgaaacggttgat
gaagggcaaaactttacgatcatcgtcgattacgcccacacgccggacagtttagaaaat
gccttaaaaacggtgcgccaattggcgaagcgaaacgtgtatgtcgtcatcggctgcggc
ggcgaccgcgaccggtcgaaacggccgctcatggcgcaggtggcggtgcggtatgcggat
gtcgctatttttacctccgacaatccgcgttcggaagacccgaagcaaattttgcgcgac
atggaagcgggagtaagcgctgagatcggaaagcatgtgacgattcctgaccgtgaagag
gcgatccgctacgccattggccaggcgcaggaaggcgatgttgtgttgattgccggcaaa
gggcatgaaacgtatcaaatcattggcaacgatgtgattgagtttgacgatcgcgctgtt
gcccgagcggcagtgaaggagagaggatga

DBGET integrated database retrieval system