KEGG   Geobacillus sp. Y412MC52: GYMC52_1041Help
Entry
GYMC52_1041       CDS       T01399                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    GYMC52_1041
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GYMC52_1041
Enzymes [BR:gya01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     GYMC52_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1073564..1074490
Genome map
AA seq 308 aa AA seqDB search
MTHLFALSELPLDEIHRLLDEAEAFRSGRIWRPAAPMYVANLFFEPSTRTKCSFEMAERK
LGLHVIPFDPERSSVQKGETLYDTVRTLEAIGVDAVVIRHHEDAYFEALRHAVGIPIINA
GDGCGHHPTQSLLDLLTIRQEFGAFTGLTVAIIGDIRHSRVARSNAEVLTRLGANVLFSG
PAEWKDETNPYGTYVDIDEAIARADVVMLLRIQHERHAETMGLTKEEYHARYGLTLERAR
RMKSGAIILHPAPVNRGVEIASELVEAKASRIFKQMENGVYVRMAVLKRAMEGRMEHGRM
AEKWHVVQ
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacccatcttttcgcattaagtgaactgccgcttgatgaaatccaccgtttgctcgat
gaagcggaagcgttccgcagcgggcgcatctggcgcccggcggcgccgatgtacgtcgcc
aacttgtttttcgaaccgagcacgcgcacgaaatgcagcttcgagatggcggaacggaag
cttgggcttcatgtcattccatttgacccggaacgctcgagcgtgcaaaaaggggagacg
ctgtacgataccgtacggacgcttgaggcgatcggcgtcgatgcggttgtcatccgccat
cacgaagatgcgtatttcgaagcgctccgccatgcggtcggcattccgatcatcaacgcc
ggtgacggctgcgggcaccatccgacccagtcgctcttggatttattgacgatccgccaa
gagtttggcgccttcactggcttgacggtggcgatcatcggcgacatccgtcatagccgc
gtcgcccgctccaatgcggaagtgttgacaaggctgggggcaaacgtcctgttttccgga
ccggcggagtggaaagatgaaacgaatccgtacgggacgtacgtcgacatcgatgaggcc
atcgcccgcgccgatgtcgtgatgcttttgcgcatccaacatgaacgccatgcggaaacg
atggggctgacaaaagaagagtaccatgcgcggtacgggctgacgcttgagcgggcgcgg
cggatgaaatcgggcgccatcatcttgcacccggcgccggtcaaccgcggggtcgaaatc
gcaagcgaacttgtcgaagcgaaggcatcgcgcatttttaaacaaatggaaaacggcgtc
tacgtgcggatggctgtcttaaaacgggcaatggaagggagaatggagcatgggcgtatg
gctgaaaaatggcatgtcgttcaataa

DBGET integrated database retrieval system