KEGG   Geobacillus sp. Y412MC52: GYMC52_1115Help
Entry
GYMC52_1115       CDS       T01399                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYMC52_1115
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GYMC52_1115
   00640 Propanoate metabolism
    GYMC52_1115
   00660 C5-Branched dibasic acid metabolism
    GYMC52_1115
Enzymes [BR:gya01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GYMC52_1115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
1145112..1146272
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRSYGVSVPNGRVAFTVDEAVEAAKELGAPVCVVKAQIHAGGRGKAGGV
KVAKSLEEVRTYASELLGKVLVTHQTGPEGKEVKRLLIEEGCDIQKEYYIGLVVDRATSR
VVLMGSEEGGTEIEEVAAKTPEKIFKEYIDPAVGLQAFQARRLAFNINIPKHLVNQAVKF
MMGLYQVFVDKDCSIAEINPLVVTGDGKVMALDAKLNFDSNALYRHPDILEYRDLDEEDP
KEVEASKYDLNYIALDGNIGCMVNGAGLAMATMDIIKYYGGEPANFLDVGGGASEEKVRE
AFKIILSDPNVKGIFVNIFGGIMKCDVIASGIVAATKQVGLTLPLVVRLEGTNVELGKKI
LQESGLNIIAAESMADGAQKIVELVR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgaataccaagcaaaagaaattttgcgaagctatggtgtgagcgtgccg
aacggccgcgtcgcgttcacggtggatgaagcggtcgaagcggcgaaagagctcggcgcg
ccggtgtgtgtcgtcaaagcgcaaatccatgccggcgggcgcggcaaagcgggcggggtg
aaagtggcaaaaagcctcgaggaagtccgtacatacgccagcgaattgctcggcaaagtg
ctcgtcacccatcaaaccggcccggaaggaaaagaagtgaaacggctgttgattgaagaa
gggtgcgacatccaaaaagaatactacatcggccttgtcgtcgaccgcgccacctcgcgc
gtcgtgttaatggggtcggaagaaggcggaacggaaatcgaagaagtggcggcgaaaacg
ccggagaaaatttttaaagaatacattgatccagccgtcgggcttcaagcgttccaagcg
cgccgattggctttcaacatcaacattccgaagcatctcgtcaaccaagcggtcaaattt
atgatgggcttgtaccaagtgtttgtcgataaagactgctcgatcgccgaaatcaacccg
cttgtcgtcaccggcgacggcaaagtgatggcgcttgatgcgaagctgaatttcgattca
aacgccttataccgccatccggacatccttgaataccgcgacttggatgaagaagacccg
aaagaagtcgaagcgtcgaaatacgacttgaactacatcgctcttgacggcaacatcggc
tgcatggtcaacggcgccggcttggcgatggcgacaatggacatcatcaaatattacgga
ggcgagccggctaacttcctcgatgtcggcggcggcgccagcgaggaaaaagtaagggaa
gcgttcaaaatcattttgtccgacccgaacgtcaaaggcattttcgtcaacattttcggc
ggcattatgaaatgcgatgtcatcgcgagcggcatcgtcgcggcgacgaagcaagtcggt
ttgacgcttccgcttgtcgtccggcttgaaggaacgaacgttgagcttgggaaaaagatt
ttgcaagagtcgggcttaaacattattgcggccgaatcgatggcggacggagcacaaaaa
atcgtcgagctagtacgttaa

DBGET integrated database retrieval system