KEGG   Geobacillus sp. Y412MC52: GYMC52_1148Help
Entry
GYMC52_1148       CDS       T01399                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gya00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GYMC52_1148
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GYMC52_1148
Enzymes [BR:gya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GYMC52_1148
Two-component system [BR:gya02022]
 CheA family
  CheA-CheYBV
   GYMC52_1148
Bacterial motility proteins [BR:gya02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GYMC52_1148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1174873..1175922
Genome map
AA seq 349 aa AA seqDB search
MKTIKVLVVDDSAFMRKWISDFLSEHPRLEVIGTARNGREALEKIAALRPDVVTLDVEMP
VMNGLETLQRIMRDHPVPVVMVSSTTTEGAENTIDAMQYGAVDFVAKPSGPISLDLYKVK
DELIGKVLHASEANVAALTAPRRQRPSWRPSFKAAARPQQAIVAIGTSTGGPRALETVLT
QLPPDLAAPVVAVQHMPKGFTTSLANRLDALAAITVKEAEDGEVLQNGTAYIAPGGVHLI
VREEGGALKARFDESPPRAGHRPAVDVLFESLAAIRRCRKIAVIMTGMGSDGTSGLKKLK
ESGNTKAIAEARETAVVFGMPRAAIEAGVVDVIVPLDSIAAAIVQLIGE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgatcaaggtgcttgtcgtcgatgactcggcgtttatgcgcaaatggatcagt
gattttttgtccgagcatccgcgcctcgaagtcatcggaacagctcgcaacggccgggag
gcgctcgagaaaatcgctgccctaaggccggatgtcgtgacgcttgatgtggaaatgccg
gtcatgaacggactcgaaacgttgcagcgcatcatgcgggaccatcccgtgccggtcgtc
atggtgtcaagcacgacgaccgaaggggcggaaaacacgatcgacgccatgcagtacggg
gcggtcgactttgtcgctaagccgtccggaccgatttcgctcgatttgtacaaagtgaaa
gacgagctgattggcaaagtgctgcacgcgagcgaagcgaacgtggctgccttgactgcc
ccgcgccgccaacgtccgtcttggcgcccatcgttcaaagcggcggcgcggccgcaacag
gccatcgtcgcgatcggcacttccaccggcggcccgcgcgcgctcgagacggtgctgacg
cagcttccgcccgatctagccgctccggtcgtcgctgtccagcatatgcccaaaggattt
acgacatcgctcgccaaccggcttgatgcgcttgccgcgatcacggtcaaggaggcggaa
gacggggaagtgctgcaaaatggcaccgcctatatcgcgccaggcggtgtccatctcatc
gttcgcgaagaaggcggcgcgcttaaagcccgtttcgacgaatcgccgccgcgcgccggc
catcgtccggctgttgacgtgttgttcgagtcgctcgctgccattcgccgctgtcggaaa
atcgcggtgatcatgaccgggatgggaagcgacggaacatcggggttgaaaaagctgaag
gaaagcgggaacacaaaagcgatcgcggaagcgcgcgagacagccgttgtctttgggatg
ccaagagcggcgatcgaggctggcgtcgttgatgtcatcgttccgcttgacagcatcgcc
gctgccatcgtccaattgatcggggagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system