KEGG   Geobacillus sp. Y412MC52: GYMC52_1148Help
Entry
GYMC52_1148       CDS       T01399                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:gya02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:gya02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1174873..1175922
Genome map
AA seq 349 aa AA seqDB search
MKTIKVLVVDDSAFMRKWISDFLSEHPRLEVIGTARNGREALEKIAALRPDVVTLDVEMP
VMNGLETLQRIMRDHPVPVVMVSSTTTEGAENTIDAMQYGAVDFVAKPSGPISLDLYKVK
DELIGKVLHASEANVAALTAPRRQRPSWRPSFKAAARPQQAIVAIGTSTGGPRALETVLT
QLPPDLAAPVVAVQHMPKGFTTSLANRLDALAAITVKEAEDGEVLQNGTAYIAPGGVHLI
VREEGGALKARFDESPPRAGHRPAVDVLFESLAAIRRCRKIAVIMTGMGSDGTSGLKKLK
ESGNTKAIAEARETAVVFGMPRAAIEAGVVDVIVPLDSIAAAIVQLIGE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgatcaaggtgcttgtcgtcgatgactcggcgtttatgcgcaaatggatcagt
gattttttgtccgagcatccgcgcctcgaagtcatcggaacagctcgcaacggccgggag
gcgctcgagaaaatcgctgccctaaggccggatgtcgtgacgcttgatgtggaaatgccg
gtcatgaacggactcgaaacgttgcagcgcatcatgcgggaccatcccgtgccggtcgtc
atggtgtcaagcacgacgaccgaaggggcggaaaacacgatcgacgccatgcagtacggg
gcggtcgactttgtcgctaagccgtccggaccgatttcgctcgatttgtacaaagtgaaa
gacgagctgattggcaaagtgctgcacgcgagcgaagcgaacgtggctgccttgactgcc
ccgcgccgccaacgtccgtcttggcgcccatcgttcaaagcggcggcgcggccgcaacag
gccatcgtcgcgatcggcacttccaccggcggcccgcgcgcgctcgagacggtgctgacg
cagcttccgcccgatctagccgctccggtcgtcgctgtccagcatatgcccaaaggattt
acgacatcgctcgccaaccggcttgatgcgcttgccgcgatcacggtcaaggaggcggaa
gacggggaagtgctgcaaaatggcaccgcctatatcgcgccaggcggtgtccatctcatc
gttcgcgaagaaggcggcgcgcttaaagcccgtttcgacgaatcgccgccgcgcgccggc
catcgtccggctgttgacgtgttgttcgagtcgctcgctgccattcgccgctgtcggaaa
atcgcggtgatcatgaccgggatgggaagcgacggaacatcggggttgaaaaagctgaag
gaaagcgggaacacaaaagcgatcgcggaagcgcgcgagacagccgttgtctttgggatg
ccaagagcggcgatcgaggctggcgtcgttgatgtcatcgttccgcttgacagcatcgcc
gctgccatcgtccaattgatcggggagtga

DBGET integrated database retrieval system