KEGG   Geobacillus sp. Y412MC52: GYMC52_1275Help
Entry
GYMC52_1275       CDS       T01399                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gya00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1308385..1309875
Genome map
AA seq 496 aa AA seqDB search
MNQYILAIDQGTTSSRAILFNQKGEIVHMAQKEFTQYFPQPGWVEHNANEIWGSVLAVIA
SVLSEAQVKPEQVAAIGITNQRETTVVWEKDTGNPIYNAIVWQSRQTAGICDELKAKGYD
PLFREKTGLLIDAYFSGTKVKWILDHVEGARERAERGELLFGTIDTWLIWKLSGGRAHVT
DYSNASRTLMFNIHTLEWDDELLAILNVPKAMLPEVRPSSEVYAKTVPHHFFGVEVPIAG
AAGDQQAALFGQACFTEGMAKNTYGTGCFMLMNTGEKAVQSKHGLLTTIAWGIDGKVEYA
LEGSIFVAGSAIQWLRDGLRMIKTAADSEAYAEKVESTDGVYVVPAFVGLGTPYWDSEVR
GAVFGLTRGTTKEHFIRATLESLAYQTKDVLAAMEADSGISLTTLRVDGGAVKNNFLMQF
QSDLLAVPVERPVVNETTALGAAYLAGLAVGYWNSRDDIAAQWQLERRFEPKMDDDKRTM
LYDGWKKAVRAAMAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatacattttagccatcgaccaaggcacaaccagctcgcgcgcgattttgttc
aatcaaaagggcgaaatcgttcatatggcgcaaaaagagtttacgcaatattttccgcag
cccggctgggtcgagcacaacgccaatgaaatttggggatcggtgcttgctgtcattgcc
agcgtcttgtccgaggcgcaagtgaagccggaacaagtggcggcgatcggcattacgaac
cagcgggaaacgacggttgtgtgggagaaagacaccggcaacccgatttacaacgccatc
gtctggcagtcgcggcagacggccggcatttgcgatgaactgaaagcgaaagggtatgac
ccgctattccgcgaaaaaaccggcttgcttattgacgcctatttttccgggacaaaagtg
aaatggattttggaccatgtcgagggggcgcgcgaacgggcggagcgaggagagctgctc
tttggcacgattgatacgtggctcatttggaagctgtccggcggccgcgcccatgtaacc
gattactcgaacgcgtcgcgcacattaatgtttaacattcatacgctcgagtgggatgac
gagctgcttgcgattttaaacgtgccaaaggcgatgcttcctgaggtgcgcccgtcctcg
gaagtatatgcgaaaacggttccgcatcatttctttggtgtggaggtgccgatcgcggga
gccgcgggcgaccagcaggcggctttgttcggccaggcgtgctttacggaagggatggcg
aaaaatacgtacggcaccggctgctttatgctgatgaatacgggggaaaaagcggtgcaa
tcgaaacacgggctgctcacaacgatcgcctggggaattgacggcaaggttgaatacgcc
cttgaaggcagcatcttcgtcgccggttcggccattcaatggctgcgcgacggcttgcgg
atgatcaaaactgcggcggacagcgaagcgtacgccgaaaaagtcgagtcgaccgacggg
gtgtatgtcgtcccagcgttcgtcggcctcggcaccccgtattgggacagcgaagtgcga
ggcgcggtgtttggcctcacgcgcggcacgacgaaagagcatttcatccgggcgacgttg
gaatcgctcgcctaccagacaaaagatgtgcttgccgccatggaagccgattccggcatc
tcgctgacgacgctgcgcgttgacggcggggccgtgaaaaacaacttcctcatgcagttc
cagagcgatttgctggccgttccggttgaacggccggtcgtgaatgaaacgacggccttg
ggcgcggcgtatttggccggattggccgtcggctattggaacagccgggatgacatcgcc
gcccaatggcagcttgagcgccggtttgagccgaagatggatgatgacaagcgaacgatg
ctctacgatggctggaaaaaagcggtgcgggcggcgatggcgtttaaatga

DBGET integrated database retrieval system