KEGG   Geobacillus sp. Y412MC52: GYMC52_1307Help
Entry
GYMC52_1307       CDS       T01399                                 

Definition
type III site-specific deoxyribonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
gya  Geobacillus sp. Y412MC52
Brite
Enzymes [BR:gya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     GYMC52_1307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1345661..1348615
Genome map
AA seq 984 aa AA seqDB search
MKLKFNADLDYQRRAVESVVHIFKGQELSQSNFTVSYGPDAGMLQTDLGVGNRLDLTPEE
ILKNVQDIQVRNGLPRSERLDGMHFTIEMETGTGKTYVYLRTIYELHKHYGFTKFVIVVP
SVAIREGVYKSLQITRDHFDELYDRTPAEYFIYDSQKLDQVRNFATATTIQIMIINIDAF
RKSFEDPEKEDKANVIHRPNDRLNGYRPIEFIRQTNPIVIIDEPQSVDTTPKSKEAIASL
NPLCTLRYSATHVDKYHMVYRLDAVDAYNQKLVKKIEVMSVRSEPSFNVPYIKLVEVKER
KAKLELDVESRGKIKRTTKTVKYGDDLYDVSGERELYRGYIVEQIDWTEGNEAVEINGYR
LRVGDAIGDVDDDAIKRYQIRKTIEEHLNKELWLRPRGIKVLSLFFIDKVAHYRDYDQNG
NPIKGKYASMFEEEYRNLMQKPKYRPLWDDPGIDQDIEKVHNGYFAQDKKGRLKDTKGNT
EADTDVYNLIMRDKERLLSLDEPLRFIFSHSALREGWDNPNVFQICTLKDSSGTYVSRRQ
EIGRGLRLAVDQNGERVHDDHINILTVMANESYEEFVATLQKEIEEDTGIQFGKIEKHVF
AKLVYVDEATDEPVQMGYDLSLKLYEELKQNGYIDKQGKATEKLKRAIENYDLHLSDEFQ
PWRSSIVKEIKRHLQALPIKDGTKKKKVHVNMAVLNQEEFRRLWDKIKYKTVYSVDFDSE
QLIDLCIAAIQEMRPIEKIRIVSRKGRVEIDHVTGVQAQTISEKVEDYVSLHHTLPDVVT
ELQNRTNLTRKTIVRILTGCKRLDDFKNNPQKFIEEVANIIQRQMRLLLKDGVKYYKIGD
DAYYAVELFQNEELLAYLNDNAIPSEKSPFDHILYDSDVEERFAKRFEHDENVKVYVKLP
SWFKIDTPIGSYNPDWALVIEKDGEEKLYFVLETKGQEWEDELRPGEAAKIAFARKHFQA
LGTDVEFIGPENDVERFMLRALSR
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaagtttaacgcggatttggactaccaacggcgcgcggtggagtcggtggtg
catattttcaaaggacaggaactgagccagtcgaacttcaccgtttcgtacggccctgat
gcgggaatgcttcaaacggacttgggcgtcgggaatcggcttgacctgacgcctgaggaa
attttaaaaaacgtccaagacatccaggtgagaaacggcctgccacgcagcgagcggctc
gatggcatgcattttacgattgaaatggaaacagggacggggaagacgtacgtatatttg
cggacgatttatgagctccataagcattacgggtttacgaaatttgtcatcgtcgtcccg
tcggttgcgattcgcgaaggggtgtacaagtcgctgcaaatcacccgcgaccatttcgat
gaactgtacgaccgcactccggcggaatattttatttacgattcgcaaaagcttgaccaa
gtgcgcaattttgcgacggcgacaacgattcaaattatgatcatcaatatcgatgcgttt
cgcaaaagcttcgaagatccggaaaaggaggataaggcgaacgtcattcatcggccaaac
gatcgtttaaatgggtaccgcccgattgagtttatccgacagacgaatccgattgtcatc
atcgatgaaccgcaaagcgtcgatacgacgccgaagtcgaaggaggcgatcgcgtcgctg
aacccgctttgcacgctgcgctactcggcgacgcatgtggacaagtatcatatggtgtac
cgccttgatgcggttgacgcctataatcaaaagctggtgaaaaaaatcgaagtcatgtcc
gtccgctctgaaccgtcgttcaatgtgccgtacatcaaactcgttgaggtgaaagagcgg
aaagcgaaacttgagctcgatgtcgagtcgcgcgggaagatcaaacggacgacgaaaacg
gtcaaatacggcgatgacttgtatgacgtttcgggggagcgcgaactgtaccgcggctat
atcgtcgagcaaatcgattggacggaaggaaatgaagcggttgaaatcaacggctatcga
ctcagggtgggcgacgcgattggagatgtcgatgacgatgccatcaagcggtatcaaatc
cgcaaaacgattgaagaacatttaaataaggaattgtggctccgcccgcgcgggattaaa
gtattaagtctgttcttcatcgacaaagtcgctcattaccgtgattatgatcaaaacggc
aatccaatcaaaggaaaatatgcgtcgatgtttgaggaagagtatcggaacttaatgcaa
aagccgaaataccgtccgctctgggacgacccgggcattgaccaagatatcgagaaggtg
cataatggctattttgctcaagataaaaaaggacggttgaaagatacgaaagggaataca
gaggcggatacggatgtatacaatctcattatgagggacaaagaacggctgctcagcctc
gatgagccgctccgcttcattttctcccattctgcgctccgtgaaggatgggacaacccg
aacgtcttccaaatttgcacgttgaaagactcgtccggcacgtatgtatccagacgccaa
gaaatcgggcgcggattgcggctggccgtcgatcaaaacggagagcgggtgcatgacgat
catatcaacatattgacggttatggcgaatgagtcatatgaagaattcgtcgctacgttg
caaaaagagattgaagaggatacgggcatccagttcggcaaaatcgaaaaacatgtattt
gccaaactcgtttatgtggatgaggcgacggacgagccggtgcaaatgggttatgattta
tcattgaagctgtatgaggaattaaaacaaaacggctatattgacaaacagggcaaagca
acggaaaaactcaaacgagccattgaaaactatgatctccatctgagcgatgaattccag
ccctggcgatcgtccatcgtgaaagagatcaaacgccatttgcaagcattgccgatcaaa
gatgggacgaaaaagaaaaaagtccatgtcaatatggcagtccttaatcaagaggagttc
aggcggctgtgggataaaatcaaatacaaaaccgtctattccgttgattttgacagcgaa
cagctcattgacctgtgcattgccgccattcaggaaatgaggccgattgagaaaatccgc
attgtcagccgaaaaggacgggtggaaatcgaccatgtgacaggcgtgcaggcgcaaacg
atcagcgaaaaagtggaagattacgtgagcttgcaccatacgctcccggatgttgtcacc
gagctgcaaaaccggacgaatttaacgcggaagacgatcgtgcgcattttgaccggctgc
aagcggctcgatgatttcaaaaacaatccgcaaaagtttattgaagaagtggcgaacatc
atccagcgccaaatgaggctgttgctgaaagatggcgtgaaatattacaaaattggtgat
gatgcgtattacgcggtcgaactgttccaaaacgaagagctgctcgcctatttgaacgac
aacgccatcccgagcgaaaaatcgccgtttgaccatatcctttacgattccgatgtggaa
gagcggttcgccaaacgttttgaacacgatgagaacgtaaaagtgtacgtcaaactgccg
agttggtttaaaattgacacaccgatcggctcctacaatcccgactgggcgcttgtcatc
gaaaaggatggagaggaaaaactgtacttcgtcctcgagacgaaaggacaggaatgggag
gacgaactgcgtcccggtgaagcagcgaaaattgccttcgcccgcaaacactttcaagcc
cttggaacggacgtggaattcatcggaccagagaatgatgtcgagcggtttatgctgcga
gccttaagccgttga

DBGET integrated database retrieval system