KEGG   Geobacillus sp. Y412MC52: GYMC52_1703Help
Entry
GYMC52_1703       CDS       T01399                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GYMC52_1703
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYMC52_1703
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GYMC52_1703
Enzymes [BR:gya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GYMC52_1703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(1750607..1751824)
Genome map
AA seq 405 aa AA seqDB search
MSFSYVSHLYCPKCERTYDVDQIHQLCECGSPLLVAYDLESMRQKVKRDVLREREANLWR
YHELLPVKHPEHIVSLGEGMTPLVPMMRLGRKIGIEALYMKDEGVIPTGTFKARGAAVGV
SKAKELGVKQLAMPTNGNAGAAWSLYAARAGIQATVVMPVDAPELTRKECAIAGAELYLV
NGLISDAGQIVAKAIREYGWYDASTLKEPYRIEGKKTMGLEIAEQFSWQLPDVILYPTGG
GVGLIGIYKAIKELQALGWVDGRMPRLVAVQAEHCAPIVKAWKEKKRESKFWPNAHTVAF
GINVPKALGDFLVLEAVYETDGCAIAVNDEAILAEQRTAAELEGAFICPEGAAAFAAART
LRESGWIRDGETVVVLNTGTGLKYADTVDVHPPVLEPGDMLPKEN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcagctacgtgtctcatctgtattgtccgaagtgtgaacgtacatacgatgtc
gaccaaatccatcaactttgcgaatgcggttcgccgcttcttgtcgcttacgacttggag
tcgatgcgccaaaaagtcaagagggatgtgctgagggaacgtgaagcgaatttatggcgt
tatcatgagttgctgccggtaaagcatcctgaacatatcgtgtcgctcggcgaagggatg
acgccgcttgtgccgatgatgcggcttggcagaaagatcggcattgaagcgctctacatg
aaagacgaaggggtcattccaacaggaacgttcaaagcccgcggggcggcggtcggggtt
tccaaagccaaggaactgggcgtcaagcagcttgcgatgccgacaaacggcaacgccggc
gcggcatggtcgctctacgcggcgcgggcgggcattcaggcgacagtcgtcatgccggtt
gatgcaccggaactgacgcgaaaggaatgcgccatcgctggggcggaactgtatttagtc
aacggcctcattagcgatgccgggcaaatcgtcgccaaagcgatccgcgaatacggctgg
tacgatgcgtcgacgttgaaagaaccgtaccggattgaagggaagaaaacgatgggactg
gagatcgccgaacaattctcgtggcagctcccggatgtcattttgtatccgaccggcggc
ggcgtcgggttgatcggcatttacaaggcgatcaaagaattgcaggcgctcggctgggtg
gacggccgcatgccgcggcttgtcgctgtgcaggccgagcattgcgcgccgatcgtcaag
gcgtggaaggagaaaaaacgtgaatcgaagttttggccgaacgcccatacagtggcgttt
ggcatcaatgtgccgaaagcgcttggcgactttcttgttcttgaggcggtgtatgagacg
gacggttgcgctattgccgtcaacgatgaagcgattttggctgaacagcggacggcagcc
gaactcgaaggggcgttcatttgcccggaaggagcggcggcgtttgcggcggcacgaacg
ttgcgcgagagcggttggattcgtgatggggagacggtcgtcgtattaaataccggaacc
gggctgaaatacgccgatacggtggacgtccatccgccggtgctcgagccgggggatatg
cttccaaaggagaattga

DBGET integrated database retrieval system