KEGG   Geobacillus sp. Y412MC52: GYMC52_1818Help
Entry
GYMC52_1818       CDS       T01399                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:gya00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:gya00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1867129..1868466)
Genome map
AA seq 445 aa AA seqDB search
MAYFPNIGTIPYEGPESRNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG
VGNMIRPWDKYSGMDLAKARVEAAFELFEKLNVPFFCFHDVDIAPEGETLSETYKNLDEI
VDMIEEYMKTSKTKLLWNTANLFSHPRFVHGAATSCNADVFAYAAAKVKKGLEIAKRLGA
ENYVFWGGREGYETLLNTDMKLELDNLARFLHMAVDYAKEIGFDGQFLIEPKPKEPTKHQ
YDFDVATALAFLQTYGLKDHFKFNIEANHATLAGHTFEHELRVARIHGMLGSVDANQGDT
LLGWDTDEFPTDLYATTLAMYEILQNGGLGRGGLNFDAKVRRGSFEPEDLFYAHIAGMDS
FAIGLKVAHRLLEDRVFEQFIEERYKSYTEGIGREIVEGTADFKKLEEYALQLGEIRNAS
GRLERLKTLLNQYLLEVSVPSVSRS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatttcccgaatatcggaaccattccatatgaaggaccggagtcgcgcaatccg
ttggcgtttaagttttataatccggaagaaaaagtcggcgacaaaacaatggaggagcat
ttgcgcttttcggtcgcctattggcatacgttcacgggggatggatcggatccgtttggc
gtcggcaatatgattcgtccgtgggacaaatatagcggcatggatctagcaaaggcgcgc
gtcgaggcggcgtttgagctgtttgaaaagctgaacgttccgtttttctgcttccatgac
gtcgacattgcgccagaaggggaaacgctcagcgagacgtacaaaaacttggatgaaatc
gtcgatatgattgaagagtacatgaaaacaagcaaaacgaagctgctgtggaatacggcg
aacttgttcagccatccgcgcttcgttcacggggcggcgacgtcgtgcaatgccgatgtg
ttcgcctatgcggcggcgaaagtgaaaaaagggttggagatcgccaaacggctcggagcg
gaaaactacgtgttctggggcggccgggaaggttatgagacgctgctgaacacggacatg
aagctggaacttgacaatttggctcgcttcttgcacatggcggtcgactatgcgaaagaa
atcggatttgacggccagtttttgatcgagccgaagccgaaagagccgacgaagcaccaa
tatgacttcgatgtggcgacggcgttggcgttcttgcagacatatgggctgaaagatcat
ttcaaattcaatattgaagcgaaccatgcgacattggccgggcatacgtttgagcacgag
ctgcgcgtcgcccgcattcatggcatgttgggctcggtcgatgcgaaccaaggcgatacg
ctgctcggctgggatacggacgagttcccgacagatttgtatgcgacgacgctggcgatg
tatgaaattttgcaaaacggcggccttgggcgcggcggcttgaactttgacgcgaaagtg
cggagaggctcgtttgaaccggaggacttgttctacgctcatatcgccgggatggacagc
tttgcgatcggtttgaaagtcgcccatcgcttgttggaagaccgcgtgtttgaacagttc
atcgaagaacggtacaaaagctatacagaaggcatcggccgcgagatcgtcgaagggacg
gcggacttcaaaaagcttgaggagtacgccttgcagctcggcgaaattcgcaatgcgtcc
ggccgtctcgaacgcttgaaaacgctgctcaaccaatatttgttggaagtcagcgtgccg
agcgtatcccgttcgtga

DBGET integrated database retrieval system