KEGG   Geobacillus sp. Y412MC52: GYMC52_2002Help
Entry
GYMC52_2002       CDS       T01399                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gya01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gya00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2072571..2073695
Genome map
AA seq 374 aa AA seqDB search
MKRQRVVVKIGSSSLTDPKGGLCHDKLFDHVEAIAYLKQLGHDVILITSGAVAAGFGPLG
YPARPTTIAGKQAAAAVGQSLLMQAYSSAFAQFGFTAAQLLLTRSDFYSRERFRNLFATI
TTLLENGAVPIINENDSVSIEELTFGDNDMLSALVAGFLHADALILLTDINGLYDANPKT
NPQAKKYAFLPEITDEMIEAAGGIGSAVGTGGMRSKLLAARKALSFGVSVFIGAGSGKEK
LADILAGKGDGTYIGAPFPKQMQMRKQWIAYHAPVAGTVTVDSGAEEALLMRGKSLLPAG
VTAVSGDFHAMDVVDVINEKGITIGRGQVYYAAADLEKVKGLPSEEARQYSYLHRPEVIH
RDNWVTLRKESVSK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggcagcgcgtggtggtcaaaatcggcagcagttcgctcaccgatccgaaaggc
ggcctttgccatgacaagctgttcgatcacgttgaggcgatcgcttatctcaaacagctc
ggccatgacgtcattctcatcacgtccggcgctgtcgccgctggtttcggacctttaggc
tacccggcgcgcccgacgacaatcgccgggaaacaggcggccgcggccgtcgggcaaagt
ttgctcatgcaggcgtacagctcggcgttcgcccaattcggctttacggccgctcagctg
ttgttgacgcgcagcgacttttacagccgcgagcggttccgcaacttgtttgccacgatc
accacactgcttgagaacggcgccgtgccgatcattaatgaaaacgactccgtttccatc
gaggaattgacatttggcgacaatgacatgctttcggcgcttgtcgccggctttttgcac
gctgatgcgctcattttgcttacggacattaacgggttgtatgacgccaatccgaaaacg
aatccgcaggcgaaaaaatacgcctttttgccggaaatcaccgatgagatgatcgaagcc
gccggcggcatcggttcagccgtcggcaccggcgggatgcgctcgaagcttctcgcggct
cgaaaagcactctcgtttggcgtcagcgtgttcatcggcgcagggagcggcaaagaaaaa
ctggctgatattttagctggaaaaggagacggcacgtacatcggcgctccgtttccgaaa
caaatgcaaatgcgcaaacaatggattgcttatcatgctcctgtcgccggcacggtcacg
gtcgacagcggggctgaggaagcgttgcttatgcgtgggaaaagtttgctccccgctggc
gtaacagctgtttccggcgattttcacgccatggatgtcgtggatgtcatcaatgaaaaa
gggatcacgatcggacgcggccaagtgtattatgccgccgccgatttagagaaagtgaaa
ggacttccaagcgaggaagctcggcaatattcctaccttcaccgcccggaagtcatccac
cgcgacaattgggtcacgttgcgaaaggagagtgtatcgaaatga

DBGET integrated database retrieval system