KEGG   Geobacillus sp. Y412MC52: GYMC52_2067Help
Entry
GYMC52_2067       CDS       T01399                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GYMC52_2067
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYMC52_2067
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GYMC52_2067
Enzymes [BR:gya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GYMC52_2067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2136197..2137360)
Genome map
AA seq 387 aa AA seqDB search
MSVAQEKKGYFGEFGGSFVPPELQEVLDYLEEQFLKYKDDPEFNEEFRTYLREYVGRESP
LTFAARLTERLGGAKIYLKREDLNHTGSHKINNVIGQILLAKRMGAKRVIAETGAGQHGV
ATATACAMFGMDCTIYMGVEDTKRQALNVFRMELLGAKVVLVSKGQGRLKDAVDEALNDL
VQNYKTTFYLLGSAVGPHPYPSMVKHFQSVISEESKRQILEREGRLPDVVVACVGGGSNA
IGAFAHYLDEPSVRLIGVEPEKAATLTKGVPAVLHGFKCLVLLDENGNPQPTYSIAAGLD
YPGIGPEHSYLKVSGRAEYYTVTNEEVLEAFQLLSKTEGIIPALESAHAVAYAIKLAPTL
SKDHIIIVNLSGRGDKDVEQVFSMLQS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtagcgcaggaaaagaaaggctatttcggcgaatttggcggcagctttgttcca
cctgaactgcaggaagtgcttgactatttggaagagcagtttctgaaatataaagatgac
ccggaattcaatgaggagtttcgaacctacttgcgggagtatgtcggccgcgagagtccg
ctgacgtttgcggcgcgattgacggagcggctcggcggggcgaagatttatttgaaacgt
gaggatttgaaccataccggttcgcataaaatcaacaacgtcatcgggcaaattttgttg
gcgaaacggatgggtgcgaagcgggtcattgcggagacaggcgcgggccagcatggggtg
gcgaccgctaccgcatgcgccatgtttggcatggactgcaccatttatatgggggtagaa
gatacgaagcgtcaggcgctcaacgtgttccgcatggagctgttaggggcgaaagtcgtg
ctggtctcgaaagggcaagggcggttgaaggatgccgtggacgaggcgctgaacgatctt
gtacaaaactataagactacgttttatttgcttggttcggcggttggtccgcatccgtat
ccgtcgatggtgaaacattttcagtcggtgattagcgaagagagcaagcggcaaatttta
gagagagaagggcggcttccggatgtggtggtggcctgcgttggcgggggaagcaacgct
atcggggcgttcgcccattatttggatgaaccgagtgtgcggctcatcggtgtcgagccg
gagaaggcggcgacgttgacgaaaggggttccggcggttcttcacggattcaagtgtctc
gtgttgcttgatgaaaacggcaacccgcagcccacatactcgattgccgctgggctcgat
tatccgggcattggtccggaacatagctacttgaaagtatccgggcgtgcggaatattac
acggtcacgaacgaagaggtgcttgaggcatttcagttgctgtccaaaacggaaggaatc
atcccagcgctcgagagcgcccatgcggtggcgtacgctatcaaactcgcgccgacatta
agcaaagatcacatcatcattgtgaacttatcaggccgcggggataaagacgtcgagcaa
gtgttttcaatgttacagtcataa

DBGET integrated database retrieval system