KEGG   Geobacillus sp. Y412MC52: GYMC52_2126Help
Entry
GYMC52_2126       CDS       T01399                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    GYMC52_2126
  Lipid metabolism
   00600 Sphingolipid metabolism
    GYMC52_2126
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    GYMC52_2126
Enzymes [BR:gya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     GYMC52_2126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2202832..2205873)
Genome map
AA seq 1013 aa AA seqDB search
MKKTLTTPTLEWLSDPRVFGVNRLPAHSDHIYYETLEEAKNGVSMSMRYELNGNWKFHYA
VNPASRPAKFYQLDFDCSNWGDISVPGHIQLQGYGTPQYVNTMYPWDGHCDARPPEVPMD
YNPVGSYIKIFNLPERMKGKPVYISFQGVESAFYVWLNGQFVGYSEDSFTPAEFELTPFI
KDGENKLAVEVYQYSTGSWLEDQDFWRFSGIFRDVYLYTVPDIHVYDLHVRAELDSSYTR
GMLTADLTFLSPVPAGSRFIAELYDAKGDLVAKKDGELHSEKGTFSIAVDEPELWSAEKP
YLYKLYIQIFNEFGQLVEVVPQKVGFRRFEIINKVMHLNGKRIVFKGVNRHEFHCRRGRA
ITKEDMLWDIKTLKRHNINAVRTSHYPNQSYWYELCDEYGIYVINEMNLETHGTWQKMGR
VDPTWNVPGNNREWQDIVMDRAISMFERDKNHPSILIWSCGNESYAGEVLLNVANYFRSV
DPSRLVHYEGVFHAREYNDISDIESRMYAKPHEIEKYLTENPDKPYISCEYMHAMGNSLG
GMYKYTDLEQKYPMYQGGFIWDFIDQALVKKDRYGKEFLAYGGDFGDRPTDYGFCTNGIV
YANRELSPKMQEVKYLYQNFKLSPDQYGVNIRNESLFTDTSEYDLEYVLFLEGRELYRSK
LNVSVAPQEEKRVEFDWPLGMMADAGEYCIHASFKLKEKTLWADAGYEVAFGQFVFQIGS
KEFVVPSGKLKVVHGDVNIGVHGKDFTIMFSKQAGSLVSMNYAGKEMIAAPPAPLFWRAT
TDNDRGFLQDFYSGLWYAASLARKCVKVDVKEEAAQVNVTFTYKFSINPELEVKIGYTVY
ADGSIRVKVVYHGVENLPSMPIFAVSFKVPADYNQLEWYAMGPEENYVDRSKGARLGIFR
NQVSDNVSRYLKPQESGNRTGVRKVSLTNNNGQGIKISSITEPLECNFSPYTAFELEHAN
HHYELPNIHYTVVTVAGRQMGVGGDDSWGAPVHDEYVIKADQDMEFEFVIHKV
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacattaacaacccccacattagaatggctttcggatcctcgtgtgttcggg
gttaatcgcctgcctgcccattcggaccatatttattatgagacgttggaagaagcaaaa
aatggagtttccatgtcgatgcgctatgagttaaatggaaattggaagtttcactatgcg
gtcaatccagctagccgtcccgcgaaattttatcaacttgattttgactgctcaaactgg
ggcgatatttccgtaccagggcatattcagttgcaaggctatggaactccccagtatgta
aatacgatgtatccgtgggacggtcattgcgatgctcgtcctccagaagttcctatggat
tataatccagtaggaagctatataaaaatttttaatcttcctgaacgtatgaaagggaaa
ccggtgtatatttcttttcaaggagtggagtcggcgttttatgtttggttgaacgggcag
tttgtcgggtatagtgaggactctttcacgccggcagaatttgaacttacaccttttata
aaggatggagagaataagctcgcggttgaggtttaccagtacagcaccggaagttggctt
gaggatcaggatttctggcgtttttctggaatctttcgcgatgtatacctttatacagtg
ccagatattcatgtctatgatttacatgttcgcgccgaattggattcgtcctatacgaga
ggcatgttaacggcggaccttacctttttgtctccggtacctgccggctctaggtttatc
gctgaactgtatgatgcgaaaggcgaccttgtcgccaaaaaagacggagagcttcatagc
gaaaaggggacattttccattgcggtcgatgaaccggaattatggagcgcggagaaaccg
tatttgtataagctatatattcagatttttaacgagtttggccaattggtagaggttgtt
ccacagaaggtcggttttcgaagattcgagatcatcaataaagttatgcaccttaacgga
aaacggattgtatttaaaggcgttaaccgacatgaatttcattgccgaagaggccgggcg
atcacaaaggaagatatgctatgggatattaaaacattgaagcgtcataacattaacgca
gtccgtacgtcacactatccgaatcaaagctattggtatgaactatgcgatgaatacggc
atctatgtcattaatgaaatgaatttggaaacgcacggaacgtggcaaaaaatgggccgt
gtcgaccccacatggaatgttccagggaacaatcgagaatggcaagacattgttatggac
cgggcgatttcaatgtttgaaagggataagaaccatccttccatcctgatttggtcatgt
ggaaatgaatcgtatgctggggaagttctgttaaacgtcgccaactattttcggtcagtc
gatccgagccgtcttgtccattatgaaggagtattccatgcccgcgagtacaatgatata
agcgacatagaaagtcgtatgtacgcaaagcctcatgaaattgaaaagtatttaacagaa
aatccggataaaccatatatcagctgcgaatatatgcatgcaatggggaactcgctcggc
gggatgtacaaatatacggatttggaacaaaagtatccgatgtatcaaggtggttttatt
tgggatttcattgatcaagcccttgtgaaaaaagatcgttatggaaaagaatttttggca
tatggaggggactttggcgaccgtccaaccgattacggtttctgtacgaacggaattgtc
tatgccaaccgggagttgtcaccgaagatgcaggaagtaaaatatctttatcaaaacttt
aagctttcaccggatcaatacggtgtcaatattagaaatgaaagtcttttcactgacaca
agtgaatatgatttagaatacgtcctattccttgaagggagagagttgtatcgaagcaag
ctgaatgtatcggtagcaccgcaggaagagaaaagagtcgagttcgactggccccttggg
atgatggcagatgcaggtgaatattgcattcatgcatcatttaaattgaaagaaaaaaca
ctttgggctgatgctggttatgaggtggcattcggccagtttgtattccagattggttcc
aaggaattcgttgttcctagcggaaagttaaaagttgtccatggtgatgtcaacattggg
gtgcacggcaaagattttacgatcatgttttccaaacaggcaggaagcctagtttcaatg
aattacgcaggcaaggagatgattgcggcccctcctgcaccattgttttggagggccacg
actgataatgaccgaggttttttgcaagacttctattcggggctttggtatgcggcgagt
ttggcgcgtaaatgtgtaaaagtcgatgtgaaagaggaagcggcccaagtaaatgtcacc
tttacctacaaattttccattaaccccgaattggaagtgaaaattggttataccgtttat
gctgatggcagcattcgcgtgaaggtggtctatcatggagtcgagaatcttccgtcaatg
ccgatttttgcggtatcattcaaggttccagccgactataatcaactcgagtggtatgca
atggggcccgaagaaaactatgtcgatcgctcaaagggggcaagacttggaatttttaga
aatcaagtatctgacaatgtatcgcgctatctcaaaccgcaggaatcaggaaacagaaca
ggtgttcgtaaagtaagcttaacgaacaacaatggacagggaataaaaatttcttctata
actgaaccgttggaatgcaacttttcgccatacacagcttttgaacttgaacatgccaat
catcattacgagctgcccaatattcattatacggttgtcacggtagcaggtcgacaaatg
ggagttggcggggacgacagctggggcgccccagttcacgatgaatacgtcataaaggca
gatcaagacatggaatttgagtttgtgattcataaagtttag

DBGET integrated database retrieval system