KEGG   Geobacillus sp. Y412MC52: GYMC52_2130Help
Entry
GYMC52_2130       CDS       T01399                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gya00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2209513..2211531)
Genome map
AA seq 672 aa AA seqDB search
MNVLSSICYGGDYNPEQWPEEIWYEDAKLMQKAGVNLVSLGIFSWSKIEPSDGVFDFEWL
DKVIDILYDHGVYINLGTATATTPAWFVKKYPDSLPIDESGVIFSFGSRQHYCPNHPQLI
THIKRLVRAIAERYKNHPALKMWHVNNEYACHVSKCFCENCAVAFRKWLKERYKTIDELN
ERWGTNFWGQRYNHWDEINPPRKAPTFINPSQELDYYRFMNDSILKLFLTEKEILRGVTP
DIPVSTNFMGSFKPLNYFQWAQHVDIVTWDSYPDPREGLPIQHAMMNDLMRSLRKGQPFI
LMEQVTSHVNWRDINVPKPPGVMRLWSYATIARGADGIMFFQWRQSRAGAEKFHGAMVPH
FLNENNRIYREVTQLGQELKKLDCLVGSRIKAEVAIIFDWENWWAVELSSKPHNKLRYIP
IVEAYYRELYKRNIAVDFVRPSDDLTKYKVVIAPMLYMVKEGEDENLRQFVANGGTLIVS
FFSGIVDENDRVHLGGYPGPLRDILGIFVEEFVPYPETKVNKIYSNDGEYDCTTWADIIR
LEGAEPLATFKGDWYAGLPAVTRNCYGKGEGIYVGTYPDSNYLGRLLEQVFAKHHINPIL
EVAENVEVQQRETDEWKYLIIINHNDYEVTLSLPEDKIYQNMIDGKCFRGGELRIQGVDV
AVLREHDEAGKV
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttttatcctcaatttgttacggaggagattacaacccagagcaatggccagag
gaaatttggtatgaagatgctaagttgatgcaaaaagcgggggtgaatttagtatcttta
gggattttcagttggagcaagatcgaaccgtctgatggagtgttcgactttgaatggcta
gacaaggttatagatatactatatgaccacggtgtgtatattaacttggggacggcgact
gcaactactccagcttggtttgtaaaaaagtatccagattctttgccgatcgatgaaagc
ggtgtcattttctcgtttggcagtagacaacattattgtcctaatcatcctcaattaatt
acgcacataaagagacttgtgagggctatagcagaacggtataaaaatcatccggcactc
aaaatgtggcatgttaataatgagtatgcatgtcacgtttccaagtgtttttgtgagaat
tgtgctgtcgcgtttagaaagtggctaaaggaaagatataaaacaatcgatgaattaaat
gaacgttggggtacaaacttttggggacagcgatacaatcattgggatgaaattaatccc
cctagaaaggcaccaacttttattaatccatcccaagaacttgattactaccgttttatg
aatgactcaattctcaagttgtttttaacagaaaaggaaattttacgtggggtaacacca
gatattccagtatcaactaatttcatgggttcattcaaaccgttaaactattttcaatgg
gctcagcatgtagatattgtgacatgggactcatatcctgatcccagagagggcttgcca
attcagcacgccatgatgaatgaccttatgcgtagtttaagaaaaggtcaaccgtttatt
ttgatggagcaggtaacctcacatgttaactggcgcgatattaatgttccaaaaccgcca
ggtgtaatgcgtctatggagttatgcaactattgcccgtggtgcagatggtattatgttt
ttccagtggcgtcaaagtagagcaggagctgaaaaattccacggtgcaatggtgccccac
tttttgaacgagaataatagaatttatagggaagttacacagttagggcaagagctgaaa
aagttagattgtttggtcggatctagaatcaaggcagaggtcgcgatcatttttgattgg
gaaaactggtgggctgtcgaactaagttccaaaccacataataaactaagatatattcct
atagttgaagcttattatagggaattatataaacgtaatattgctgtcgattttgtaagg
ccatctgatgatctaacaaaatacaaagtagttatcgctccaatgttatatatggttaaa
gagggagaagatgaaaacttacggcaatttgttgctaacggtggcactttgattgtcagt
ttcttcagtggcattgtagatgaaaatgaccgtgtacatctaggcggatatcctggtcct
ctgcgagatattttggggatttttgttgaggaatttgtaccatacccagaaacaaaggta
aacaaaatatatagtaacgatggggaatatgattgtacgacgtgggcggacataatccga
ttagaaggggcagaacctctagcgacatttaagggggattggtatgcaggacttccggcg
gttacacgtaactgctacggtaaaggagaggggatttatgtcggtacttatccagatagt
aattatttaggtaggcttttagaacaggttttcgctaaacatcatattaatcccattctt
gaagtagctgaaaatgtagaggtgcaacaaagagagactgatgaatggaagtatttaatt
attatcaatcataatgattacgaagtgacactgtcactgccagaagataagatataccag
aatatgattgatgggaaatgttttcgaggaggtgaattgaggattcaaggggttgatgta
gcagtgttaagagagcatgatgaagccgggaaggtttag

DBGET integrated database retrieval system