KEGG   Geobacillus sp. Y412MC52: GYMC52_2181Help
Entry
GYMC52_2181       CDS       T01399                                 

Definition
TspO and MBR-like proteins (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GYMC52_2181
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYMC52_2181
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GYMC52_2181
Enzymes [BR:gya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GYMC52_2181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2254534..2255349)
Genome map
AA seq 271 aa AA seqDB search
MKTLPLSVNPPLFIPFIVAGDPAPDVTIDLALALEEAGADILELGVPYSDPLADGPTIQR
AAARALDGGMTLPKAIQLIGEMRKKGVNIPIILFTYYNPVLQLGEESFFALARENGADGV
LIPDLPFEESGPLRELGERFGLPLISLVAPTSKQRIERIASAAQGFLYCVSSLGVTGVRE
TLPETLGDFLREVKRHSRVPVAVGFGISAPEQVAMLKEVCDGVVVGSALVQKVEQLAPRL
QAPDEREAAVAEFSAYARSLAAPLREAYSSR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacattgccactgtccgttaatccgccgctatttatcccgtttatcgttgccggt
gatccggctcccgatgtgacgatcgatctcgccttggcgcttgaggaggccggcgctgac
atattagagcttggcgtgccgtactccgacccgctcgctgacggaccgacgattcaacgc
gccgccgcaagggcgcttgacgggggcatgacgctgccgaaagccattcagcttattggc
gagatgcgaaaaaaaggggtaaacattccgattattctctttacgtattacaatcctgtg
ttacaattaggagaagaatccttttttgctttagcgcgggaaaatggcgccgacggcgtg
ctcattcccgatttgccgtttgaggaaagcggtccgctccgcgaacttggcgaacggttt
ggtctcccgctcatttcgcttgttgcgccgacgtcgaagcagcggatcgagcggatcgct
tcggcggcgcaagggtttttgtattgcgtctcctcgctaggcgttacaggcgtgcgtgag
acgctgccggagacgctcggcgatttcctccgcgaagtgaagcggcatagccgcgtcccg
gtcgccgtcggctttggcatttcggcgccggagcaagtcgcgatgttgaaagaggtgtgc
gacggcgttgtcgtcggcagcgcgctcgtgcaaaaagtcgagcagctggctccgaggttg
caggcgccggacgaaagggaagcggccgtcgccgagttttctgcctacgcccgttcgctt
gccgcgccgcttcgagaagcctattcttcgcgctaa

DBGET integrated database retrieval system