KEGG   Geobacillus sp. Y412MC52: GYMC52_2182Help
Entry
GYMC52_2182       CDS       T01399                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gya01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:gya00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:gya00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2255324..2256538)
Genome map
AA seq 404 aa AA seqDB search
MERVPNEYGRFGDFGGKFVPETLMLPLEEIEAELDKALADESFKQEYIRILQHYSGRPTP
LTFAPNLTRQVGGAKIYLKREDLNHTGAHKINNAIGQALLAKRMGKKKLIAETGAGQHGV
AAATVAAHFGMDCIVFMGEEDIKRQELNVFRMKLLGAEVVPVSSGNRTLKDATNEAIRYW
VAHCDDHFYMIGSVVGPHPYPKMVREFQRVIGDEAKEQFLAREGKLPDVIVACVGGGSNA
IGMFYPFLQDDVRLVGVEAAGKGIDTPHHAATITKGTKGVIHGAMTYLLQDEYGQILEPY
SISAGLDYPGVGPEHAYLASIGRVRYESATDDEAVAAFQLLAQTEGIIPAIESAHAVAKA
VELAREMPPDETVLICLSGRGDKDVQTMMRHLGAREGEDIATVR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcgttccgaatgaatacggccggtttggcgatttcggcggcaagtttgtccct
gagacgctcatgcttccgcttgaggaaatcgaagcggagcttgacaaagcgcttgccgat
gaatcgttcaaacaagaatacatccgcattttgcagcattactccggtcgcccgaccccg
ctcacgttcgcgccgaatttgacacggcaagtcggcggcgcgaaaatttatttaaagcgc
gaagatttaaaccatacgggcgcccataaaatcaacaacgcgatcggccaggcgcttttg
gcaaaacggatgggcaagaaaaagctgatcgctgaaaccggagccggccagcacggcgtc
gccgcggcgacggtggccgcccatttcggcatggattgcatcgtttttatgggcgaagaa
gacatcaagcggcaggagctgaacgtgtttcgcatgaaactgttgggcgccgaagtcgtg
ccggtgtcaagcggcaaccgaacgttgaaagatgcgacgaacgaagcgattcgctattgg
gtcgcccactgcgacgaccatttttacatgatcggctcggtcgtcggtccgcatccgtac
ccgaaaatggtgcgcgagtttcagcgcgtgattggcgatgaagcgaaagaacagtttctc
gcccgtgaagggaagctgccggatgtcatcgttgcctgcgtcggcggcggcagcaacgcc
atcggcatgttttacccgtttttgcaagatgacgtccgcctcgtcggcgtcgaggcggcc
ggcaaagggatcgacactccgcaccatgcggcgaccatcacaaaagggacgaaaggggtc
atacacggggcgatgacctacctgttgcaagacgagtacggacaaattctcgaaccgtat
tcgatctcagccggccttgattaccccggcgtcggcccggaacatgcgtatttggcgagc
attggccgcgtccgctacgaaagcgcgaccgatgacgaggccgtcgctgcgtttcaattg
ttggcgcaaacggaaggcatcattccggccatcgagtcggcccatgcggtggcgaaagcc
gtcgagctcgcacgcgagatgccgccggatgaaacggtgctcatttgcctgtccggccgc
ggagataaagatgtgcaaacgatgatgcgccatcttggtgcgagggaaggtgaagacatt
gccactgtccgttaa

DBGET integrated database retrieval system