KEGG   Geobacillus sp. Y412MC52: GYMC52_2196Help
Entry
GYMC52_2196       CDS       T01399                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gya00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2268033..2268599)
Genome map
AA seq 188 aa AA seqDB search
MPEINFAQIEYAVRLILEAIGEDPNREGLVDTPKRVAKMYAEVFAGLQEDPKQHFQTVFS
EEHEELVLVKDIPFYSMCEHHLVPFFGAAHVAYIPREGKVTGLSKLARAVEAVARRPQLQ
ERITATIADSIVEALEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVFETDANARA
EVLSLIKA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgccagagatcaattttgcgcaaattgaatatgcggtccgcctcattcttgaggcgatc
ggggaagatccaaaccgcgaagggctcgtcgatacgccgaagagggtggcgaaaatgtac
gccgaggtgttcgctgggctgcaggaagacccgaagcagcactttcaaaccgtattcagc
gaggaacatgaggagcttgtgctcgtcaaagatattccgttttattcgatgtgcgaacac
catttagtgccgttttttggcgctgcccacgtcgcctatattccgcgggaagggaaagtg
accgggctgagcaagctcgctcgagccgttgaggcggtggcgcgccgcccgcagctgcaa
gagcgcatcacggcaacgatcgctgattcgatcgtcgaggcgcttgagccgcatggggtg
atggtcgtcgttgaggcggagcatatgtgcatgacgatgcgcggggtgaaaaaaccgggg
gccaaaacagtgacaacagcggtgcgcggcgtgtttgaaacagatgccaacgcccgcgct
gaagtgctttcgttaatcaaagcgtaa

DBGET integrated database retrieval system