KEGG   Geobacillus sp. Y412MC52: GYMC52_2318Help
Entry
GYMC52_2318       CDS       T01399                                 

Definition
(GenBank) glycoside hydrolase family 1
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00010  Glycolysis / Gluconeogenesis
gya00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC52_2318
   00500 Starch and sucrose metabolism
    GYMC52_2318
Enzymes [BR:gya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     GYMC52_2318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: ADU94720
JGI: GYMC52_2318
UniProt: A0A0E0TDF4
Position
complement(2373294..2374661)
Genome map
AA seq 455 aa AA seqDB search
MSQQRKSIIPDNFLWGGAVTSFQTEGAWNEGGKGLSIVDARPIPKGHSDWKVAVDFYHRY
KEDIALFKELGFTAYRTSIAWTRIFPDGEGEPNEAGLAFYDAVFDELRANGIEPVITLYH
FDLPLALAKTYNGFASRKVVDLFERYARTIFERYRGKVNYWLTFNEQNLVLEQPHLWGAI
CPEDEDPEAFAYCVCHNVFIAHAKAVKALREIAPEAKIGGMVTYLTTYPATCRPEDALAN
VQAKELFIDFFFDVFARGAYPRYVTNRLEKKGICLPLEAGDEELLRSQTVDFLSFSYYQS
QIVRHQEQDERIIKGLEPNPYLPKTKWGWAIDPIGLRIALKDVYARYEMPIFITENGIGL
EEELNEDGTVEDDERIDYLRRHIEQMKMAMEEGVEVIGYLMWGATDLLSSQGEMRKRYGV
IFVNRDDENLRDLKRYKKKSFYWFQRIIRTNGEEL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacagcgtaaatcgatcatccccgacaactttttatggggcggggcggtgacg
tcgtttcagacggaaggggcgtggaacgaaggcggcaaagggctgtcgatcgttgatgcg
cgcccgattccaaaagggcattccgactggaaagtggcggtcgatttttaccatcgctac
aaagaagacatcgctttgttcaaggagctcggctttaccgcctaccggacgagcatcgct
tggacgcgcatttttccggacggggaaggggagccgaatgaagcgggcttggcgttttat
gacgccgtgtttgatgaattgagagcgaacggcatcgagccggtcattacgctgtaccat
tttgatttgccgctggcgttggcgaaaacgtacaacggctttgcctcgcggaaagtcgtc
gacttgtttgagcggtacgcgcgcaccatatttgagcgttaccgcgggaaagtgaactat
tggctgacgttcaacgaacaaaatttagtgctcgaacaaccgcatttatggggggcgatc
tgcccggaagacgaagacccggaagcgtttgcctactgcgtctgtcataatgtgttcatc
gcccacgcgaaagccgtgaaggcgctgcgcgaaatcgctcccgaggcgaagatcggcggg
atggtgacgtatttgacgacgtatccggcgacatgccggccggaagacgctttggcgaac
gtgcaggcgaaagagctgttcattgatttcttctttgatgtgtttgcccgcggcgcctat
ccgcgttatgtgaccaaccggcttgagaaaaaaggaatctgcctgccgctcgaagcgggg
gatgaggagttgctccgttcgcagacggtcgactttttgtcgttcagctactatcaaagc
caaatcgtccgccatcaggaacaggatgagcggatcatcaaagggcttgaaccgaatccc
tatttgccaaagacgaaatggggctgggcgatcgatccgatcggtttgcggattgcctta
aaagacgtgtacgcccgttacgaaatgccgattttcatcaccgaaaacggcatcgggctt
gaggaggagctgaatgaggacggcacggtcgaagatgatgagcggatcgactatttgcgc
cgccatatcgaacaaatgaagatggccatggaagaaggggtcgaggtgatcggctatttg
atgtggggggcgacggatctattaagctcgcaaggggagatgcgcaagcgctacggcgtc
attttcgtcaaccgcgacgacgagaacttgcgcgatttgaagcgctataagaaaaaaagt
ttttattggttccagcgcatcattcgcacgaacggggaagagctgtaa

DBGET integrated database retrieval system