KEGG   Geobacillus sp. Y412MC52: GYMC52_2475Help
Entry
GYMC52_2475       CDS       T01399                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00010  Glycolysis / Gluconeogenesis
gya00052  Galactose metabolism
gya00500  Starch and sucrose metabolism
gya00520  Amino sugar and nucleotide sugar metabolism
gya00521  Streptomycin biosynthesis
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01120  Microbial metabolism in diverse environments
gya01130  Biosynthesis of antibiotics
gya01200  Carbon metabolism
Module
gya_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gya_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC52_2475
   00052 Galactose metabolism
    GYMC52_2475
   00500 Starch and sucrose metabolism
    GYMC52_2475
   00520 Amino sugar and nucleotide sugar metabolism
    GYMC52_2475
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GYMC52_2475
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GYMC52_2475
Enzymes [BR:gya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GYMC52_2475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ADU94856
JGI: GYMC52_2475
UniProt: A0A0E0TDX8
Position
complement(2536265..2537218)
Genome map
AA seq 317 aa AA seqDB search
MEPWLVGIDLGGTTIKMAFVTTEGDIVHKWEIPTNTANRGEHIVADIARSLEKTLGQLGG
AKERLLAAGIGAPGPVEEETGMLYETVNIGWTNYPLKQRLEEATGLPVSVDNDANLAALG
EMWKGAGGGARHLLFVTLGTGVGGGVIANGAIVRGINGAGGEIGHMTMIPDGGARCNCGK
TGCLETIASATGIVRIAKEKLTADERPSELRNGDVTAKAVFDAAKAGDALALEVVDEATY
YLGWALANAANVTNPEKIVIGGGVSKAGDMLVERVAAHFRRFAFPRVAAGAKLVLATLGN
DAGVIGAAWLAKELVGA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggaaccatggttggtaggcattgacctcgggggcacgacaatcaaaatggcgtttgtc
accaccgagggtgacatcgtgcacaaatgggaaattccgacgaacaccgccaatcgcggt
gagcatatcgtcgctgacattgcccgatcgcttgaaaagacgctcggccagctcggcgga
gcgaaagagaggctgcttgccgccggcatcggcgcccccggaccggtcgaagaggaaacc
ggcatgttgtatgagacggtcaatatagggtggacgaattatccattaaagcaacggctg
gaagaggcgacggggctgcccgtttcggtcgataatgatgccaatctcgccgcgcttggc
gaaatgtggaaaggagcagggggaggagcgcgacatttgttgtttgtgacgcttggcacc
ggcgttggcggcggtgtgattgccaacggagccattgtgcgcggcataaacggcgccggc
ggagagatcggacatatgacgatgatccctgatggcggcgcccgttgcaactgcggcaaa
accggatgtttggaaacgattgcgtccgccaccggcatcgtgcggatcgccaaggagaaa
ttgaccgcagatgagcgtccgagtgagcttcgcaacggggatgtgacggccaaagcggtg
tttgacgccgccaaagcgggcgatgcgctggcattggaagtggtcgatgaagcaacgtac
tatcttggttgggcgttggcgaatgccgccaatgtgacgaacccggagaaaatcgtgatc
ggcggcggcgtgtccaaggcgggtgacatgcttgtcgagcgcgtggccgcccatttccgc
cgcttcgcgttcccgcgcgtcgccgctggggcgaagcttgttttagcgacgcttggcaac
gatgccggcgtcatcggcgccgcctggctggcgaaagagcttgtcggcgcgtaa

DBGET integrated database retrieval system