KEGG   Geobacillus sp. Y412MC52: GYMC52_2596Help
Entry
GYMC52_2596       CDS       T01399                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gya00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GYMC52_2596
Enzymes [BR:gya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     GYMC52_2596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2642763..2645123)
Genome map
AA seq 786 aa AA seqDB search
MQEQQILALDGRTFIKGVCLAVIFHNEETLYTVVRVRVEETNEAPVEEEVVVTGYFPRLN
EGDVYIFYGQFRQHPRFGRQYAASQFRKQLPNTKEGVIHYLSSGLFKGIGKKTAAAIVET
LGENAIAAILRDPKALERVPKLTKKKAKQLYDALRAHEGLEQTMIALAQLGFGPQLAMKI
YQAYGEEAIDIIHENPYQLVEDIEGIGFGRADEIGRQLGISGSHPARLRAASLFVLEQAC
LQEGHVYLREEELMERIGELLDGRLSGAVDGRAISQTLLMLSEEGKLIAEQGRYYLPSLY
FAEKGIVSNIKRLLGQTPPSAFAESEFLLALGALEERLGMQYAPQQREAIQQALSSPLFI
LTGGPGTGKTTVIKGIVELFAALNGLSIDPADYKQGEPFPVLLAAPTGRAAKRMSEATGL
PAATIHRLLGWNGAEGFSRDENEPISGKLLVIDEMSMVDTWLANQLLKAVPNGMQVIFVG
DEDQLPSVGPGQVLKDLLSSGVIPFARLTEVYRQAEGSSIIELAHKMKRGVVPDDLTAPK
ADRSFIRCRAGQVVDVVRQIADNARKKGFSVKDIQVLAPMYRGPAGIDQLNKALQELFNP
PAEGKRELSVGEVVYRVGDKVLQLVNQPEDNVFNGDIGEIVAIFYAKENIEKQDLLVVSF
DGIEVTYTRQDLGQITHAYCCSVHKAQGSEFPIVILPVVKNYYRMLKRNLLYTAVTRSKQ
FLVLCGEEEAFRFGVAKQSDGARQTALAEKLAGAAAPFVEVELPFEEANMGMENVTPYDF
MGDEPS
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagagcaacaaatcctcgcccttgacggacgcacgttcattaaaggagtgtgcttg
gcggtcatttttcataatgaggaaacattgtacacggtcgtccgcgtgcgcgttgaggaa
acgaacgaagcgcccgttgaggaggaagtcgtcgtcaccggctattttccgcgtttaaac
gaaggggacgtctacatcttttacggacaattccgccaacatccgcgttttggccgccaa
tatgcggctagtcagttccgcaaacagcttccgaacacgaaagaaggagtcattcattat
ttatcgagcggtttgtttaaaggaatcggcaaaaaaacggctgcggcgattgtcgagacg
ctcggcgaaaacgcgatcgccgcgattttgcgcgaccccaaggcgctagagcgtgtgccg
aagctgacgaaaaaaaaggcgaagcagctgtacgatgcgcttcgcgcccacgaagggctt
gagcaaacgatgatcgccctcgcccagctcggttttggcccgcagctggccatgaaaatt
taccaagcgtatggcgaagaagcgattgacatcatccacgagaacccgtaccagctcgtt
gaggatatcgaagggatcggctttggccgcgctgatgaaatcgggcgccagctcggcatt
tccggcagccatccggcccggctgcgcgccgcctcgttgtttgttcttgaacaggcgtgc
ttgcaggaagggcacgtttatttgcgcgaggaagagctgatggagcgcatcggggagctg
cttgacggaaggctgagcggtgcggtggatggacgagcgatcagccaaacgcttctgatg
ttaagcgaggaagggaagctgatcgccgagcaagggcgttattatctcccttccctttac
ttcgccgagaaagggatcgtctccaacattaagcggctgctcgggcagacgccgccgtcg
gcgtttgccgagtcggagtttttgctggcgcttggggcgcttgaggaacggcttggcatg
caatatgccccccagcaaagggaagcgatccaacaagcgctttcttcgccgctgtttatt
ttgaccggcggtccgggaacggggaaaacgacggtcatcaaaggcatcgtcgagctgttt
gccgccctaaacggcctgtctattgacccggctgactacaaacaaggcgagccgtttccg
gtgctgctggccgcaccgaccggccgagcggcgaagcggatgagcgaggcgaccgggctg
ccggcggcgacgatccaccgcttgctcggctggaatggggcggaagggttcagccgcgac
gagaacgaaccgatttccggcaagctgcttgtcatcgatgagatgtcgatggtcgacacg
tggctcgccaaccagctgttaaaagccgtgccaaacggcatgcaagtcattttcgtcggc
gatgaggatcaattgccatccgtggggccagggcaagtgctgaaagacttgctctcttca
ggcgtcattccgttcgctcggttgaccgaggtgtatcgccaggcggaaggatcatcgatc
atcgagcttgctcataagatgaagcgcggcgtcgtgccggacgatttgaccgctccgaag
gcagaccgttccttcatccgctgccgtgcgggccaggtcgtcgatgtcgtgcggcaaatc
gcggacaacgcgcgcaaaaaagggttttccgtcaaagatattcaagtgctcgccccgatg
taccgtggtccagcgggcattgaccaattgaacaaggcgcttcaagagctgttcaacccg
ccggctgaggggaagcgggagctgtcggtcggtgaggtcgtctaccgcgtcggcgataag
gtgctgcagctcgtcaatcaaccggaagacaatgtgtttaacggcgacatcggcgaaatc
gttgccattttttacgccaaagaaaatatcgaaaagcaagacttgctcgtcgtctcgttt
gatggcattgaagtgacgtacacacggcaagatttaggacaaatcacccatgcgtactgc
tgttcggttcataaggcgcaaggaagcgagtttccaatcgtcattttgcccgtcgtcaaa
aactattaccggatgttgaaacggaatttgttgtatactgcggtgacaagaagcaagcag
tttctcgttttatgcggggaagaggaagcgtttcgattcggcgtcgcaaaacaaagcgac
ggagcgcgccagacggcgctcgctgagaagctggcgggggcggcggcgccgtttgtcgag
gtcgaactgccgtttgaagaggcgaacatggggatggaaaacgttacgccgtatgacttt
atgggcgatgagccaagctaa

DBGET integrated database retrieval system