KEGG   Geobacillus sp. Y412MC52: GYMC52_2627Help
Entry
GYMC52_2627       CDS       T01399                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gya00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GYMC52_2627
Enzymes [BR:gya01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     GYMC52_2627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2678302..2678886)
Genome map
AA seq 194 aa AA seqDB search
MIEFIRGYVDYVCPEYIVIDHNGIGYEIFTPNPFAFQESREAAVTVYTYEYVREGVHALY
GFPTREERNLFAKLLQVSGIGPKGGLAILAAGRPDELARAIEEENEAFLCKFPGVGKKTA
RQMILDLKGKLGALAAPAAARSAAPLSGALAEAVAALKALGYAEREIEKIIPALRKEAMS
TEQYVKRALALLLG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgagtttatccgtgggtatgtcgattacgtctgcccggaatatatcgtcatcgac
cataacggcatcggctacgagatctttacgccgaacccgtttgcgtttcaggaaagccgc
gaggcggcggtgaccgtctatacatacgaatatgtgcgcgaaggtgtgcacgccttgtac
gggttcccaacgcgcgaggagcgcaacttgttcgccaagctgctgcaagtgtcgggcatc
gggccgaaaggcggcctcgccattttggcggccgggcgtccggatgaactggcgcgggcc
atcgaggaagaaaacgaggcgtttttatgcaagtttccaggcgtgggcaaaaagacggcc
cggcaaatgattttggatttaaaagggaagctcggggcgcttgcggcgccggcggctgca
cgttcggccgcaccgctttccggtgcgctcgccgaggcggtggcggcgctcaaggcgctc
ggctacgctgaacgggagatcgagaaaatcattccggcgctccgcaaagaagcgatgtcg
acggaacagtatgtgaagcgggcgctggcgctgcttttgggataa

DBGET integrated database retrieval system