KEGG   Geobacillus sp. Y412MC52: GYMC52_2723Help
Entry
GYMC52_2723       CDS       T01399                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00071  Fatty acid degradation
gya00362  Benzoate degradation
gya01100  Metabolic pathways
gya01120  Microbial metabolism in diverse environments
gya01212  Fatty acid metabolism
Module
gya_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    GYMC52_2723
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GYMC52_2723
Enzymes [BR:gya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GYMC52_2723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADU95100
JGI: GYMC52_2723
UniProt: A0A0E0TEJ7
Position
complement(2777396..2778169)
Genome map
AA seq 257 aa AA seqDB search
MDFFRLAKEEFVAVVTFSRPPANALSSAVLKELSTVLDELETDPEVRVVLLHGEGRFFSA
GADIKEFTSIASAEEASGLSRNGQLVMERIERFSKPVIAAIHGAALGGGLELAMSCHIRV
VAENAKLGLPELQLGIIPGFAGTQRLVRYVGFGKAAEMMWTSEPITGLEAVEWGLANKAV
PEERLLDEAKALAKKIAAKSPLSVRATIELLNAAKEKSFAEAVREEAEWFGRVFVSEDAK
EGVQAFLEKRPPVFKGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggacttttttcgtttggcgaaagaggagttcgtcgccgtcgtgacgttttcgcggccg
ccggcgaacgccctttcatcagcggttttgaaagagctttcaaccgtgttggacgagctc
gagaccgatccggaagtacgcgtcgtgctgcttcatggcgaaggaagatttttctcagcc
ggcgccgatattaaagaattcacgtccatcgcttccgctgaggaggcatccggcttgtcg
cgcaacggccaactcgtgatggagcggatcgaacgcttttccaaaccagtcattgcggcg
attcacggcgccgcattaggcggtgggttggagctggctatgagctgccacattcgtgtg
gtggcggaaaacgccaaactcggccttccggagctgcagcttggcatcatccctggattt
gctggcacgcagcggcttgtgcgctacgtcggctttggcaaagcggcggaaatgatgtgg
acgagcgagccgatcaccggactcgaagcggttgaatgggggcttgccaacaaggcggtg
ccggaagagcggcttcttgatgaagcaaaagcgttggcgaaaaagatcgccgccaaaagt
ccgctttccgtccgtgcgacgattgaactgctcaacgccgcgaaggaaaaatcgtttgcc
gaggcagtgcgcgaggaggcggaatggtttggccgcgtgtttgtatccgaggatgcaaaa
gaaggcgtgcaggcgtttttggaaaaacggccgcctgtctttaaagggaaatga

DBGET integrated database retrieval system