KEGG   Geobacillus sp. Y412MC52: GYMC52_2723Help
Entry
GYMC52_2723       CDS       T01399                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:gya01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:gya00071]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2777396..2778169)
Genome map
AA seq 257 aa AA seqDB search
MDFFRLAKEEFVAVVTFSRPPANALSSAVLKELSTVLDELETDPEVRVVLLHGEGRFFSA
GADIKEFTSIASAEEASGLSRNGQLVMERIERFSKPVIAAIHGAALGGGLELAMSCHIRV
VAENAKLGLPELQLGIIPGFAGTQRLVRYVGFGKAAEMMWTSEPITGLEAVEWGLANKAV
PEERLLDEAKALAKKIAAKSPLSVRATIELLNAAKEKSFAEAVREEAEWFGRVFVSEDAK
EGVQAFLEKRPPVFKGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggacttttttcgtttggcgaaagaggagttcgtcgccgtcgtgacgttttcgcggccg
ccggcgaacgccctttcatcagcggttttgaaagagctttcaaccgtgttggacgagctc
gagaccgatccggaagtacgcgtcgtgctgcttcatggcgaaggaagatttttctcagcc
ggcgccgatattaaagaattcacgtccatcgcttccgctgaggaggcatccggcttgtcg
cgcaacggccaactcgtgatggagcggatcgaacgcttttccaaaccagtcattgcggcg
attcacggcgccgcattaggcggtgggttggagctggctatgagctgccacattcgtgtg
gtggcggaaaacgccaaactcggccttccggagctgcagcttggcatcatccctggattt
gctggcacgcagcggcttgtgcgctacgtcggctttggcaaagcggcggaaatgatgtgg
acgagcgagccgatcaccggactcgaagcggttgaatgggggcttgccaacaaggcggtg
ccggaagagcggcttcttgatgaagcaaaagcgttggcgaaaaagatcgccgccaaaagt
ccgctttccgtccgtgcgacgattgaactgctcaacgccgcgaaggaaaaatcgtttgcc
gaggcagtgcgcgaggaggcggaatggtttggccgcgtgtttgtatccgaggatgcaaaa
gaaggcgtgcaggcgtttttggaaaaacggccgcctgtctttaaagggaaatga

DBGET integrated database retrieval system