KEGG   Geobacillus sp. Y412MC52: GYMC52_2775Help
Entry
GYMC52_2775       CDS       T01399                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYMC52_2775
   01230 Biosynthesis of amino acids
    GYMC52_2775
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC52_2775
   00030 Pentose phosphate pathway
    GYMC52_2775
   00051 Fructose and mannose metabolism
    GYMC52_2775
   00052 Galactose metabolism
    GYMC52_2775
  Energy metabolism
   00680 Methane metabolism
    GYMC52_2775
Enzymes [BR:gya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GYMC52_2775
Protein phosphatases and associated proteins [BR:gya01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GYMC52_2775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2832303..2833262)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGIYHGYAGLIAGNIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVVEVMGRHAGDIALWS
GLAGGAETILIPEADYDMDDIIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQIVDHDIAEAL
AKTHTVDQRMYTLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtgtgttgacaagcggcggcgactcgccgggcatgaatgcggccatt
cgcgctgtcgtccgcaaagcgatttaccatggggtggaagtgtacggaatctaccacggg
tatgccgggttgatcgccggcaatatcaaaaagctggaagtcggggacgtcggggacatc
atccatcgcggcggcaccatcctttataccgcgcgctgcccggagtttaagacggaagaa
ggacagaaaaaggggatcgagcagctgaaaaagcacggcattgaagggctggtcgtcatc
ggcggcgacgggtcgtatcaaggggcgaaaaaattgacggagcacggcttcccgtgcgtc
ggcgtgcccgggacgatcgacaacgacattccaggcaccgatttcacgatcggttttgac
accgcgctcaatacggtcattgacgccattgacaaaatccgcgacacggcgacgtcgcat
gagcggacgtacgtcgtcgaagtgatgggccgccatgccggcgatattgcgctatggtcg
gggcttgccggaggggcggagacgattttgattccggaagcggactacgacatggacgac
atcatcgctcgcttgaagcgcggccatgaacgcggcaaaaaacacagcatcatcatcgtc
gccgagggagtcggcagcggcgtcgacttcggccggcaaattcaagaggcgaccggcttt
gagacgcgcgtgacggtgcttggccacgtgcagcgcggcggatcgccgacggcgtttgac
cgcgtgttagcgagccgcctcggcgcccgtgcggtcgagctgctccttgaaggcaaaggc
ggccgctgcgttggcattcaaaacaaccaaatcgttgaccatgacattgccgaagcgttg
gcgaaaacacatacggtcgatcagcggatgtatacattgtcgaaagagctgtcgatttaa

DBGET integrated database retrieval system