KEGG   Geobacillus sp. Y412MC52: GYMC52_2795Help
Entry
GYMC52_2795       CDS       T01399                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00010  Glycolysis / Gluconeogenesis
gya00620  Pyruvate metabolism
gya00640  Propanoate metabolism
gya00680  Methane metabolism
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01120  Microbial metabolism in diverse environments
gya01130  Biosynthesis of antibiotics
gya01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC52_2795
   00620 Pyruvate metabolism
    GYMC52_2795
   00640 Propanoate metabolism
    GYMC52_2795
  Energy metabolism
   00680 Methane metabolism
    GYMC52_2795
Enzymes [BR:gya01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GYMC52_2795
Lipid biosynthesis proteins [BR:gya01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GYMC52_2795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADU95172
JGI: GYMC52_2795
UniProt: A0A0E0TFG3
Position
2851703..2853361
Genome map
AA seq 552 aa AA seqDB search
MANNLSPASLIQSFSWDQAFAHYDWDPRSRFNAAHEVCDRYAEDPNRIALFYENALGEQK
TITYRQLRDWSNQMANVFRKLGVKKGDRVCALMPKNPALVVYILAAWKVGAVYVPLFTAF
GPQAIEYRINHSEAKVLLTNKEQRAKLPPRDNMPTLEHIFVIDGPSHDQDQPFWETLSKE
STEHSIEETTVDDLLAIQYTSGSTGMPKGAMWPHNVLINIYPYMRYAIGLRDDDVFFGGA
DPGWAYGLIFCTFAPMAFGVPIVFYEGPFKPETCYSLMEKYRVTNFAYAPTAYRAMAAAG
ADVIRRYQLNVRAMSSAGEPLNPEVIRFFQEHVGVTIHDHYGLSETLMLIGNFNAAEMEI
RPGSMGWPLPGFDVALLDENGTPVADGEVGQIAFNTDSIPNVFKGYWKDPEKTAERLVGK
WFLTGDLATKDEDGYFWFQGRADDIISSAGYRIGPFEIESCLLEHPAVVEAAAVGKPDPV
KGEIVKAFVVLREGFAPSDELADELSLFVKTRLSKHEYPREVEFVAELPKTPSGKIQRFI
LRNQEREKSIKA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggccaacaatctatcacctgcctcactcattcaatcattttcttgggatcaggcattc
gctcattacgactgggatccccgcagccggttcaacgccgcccatgaagtatgcgaccgg
tatgccgaggatccgaaccgcattgcgctgttttatgaaaacgctttaggagagcaaaaa
acgatcacctatcgacaattgcgcgattggtccaaccaaatggcgaacgtgttccgcaag
ctgggcgtgaaaaaaggggatcgcgtctgcgcgctgatgccgaaaaacccggcccttgtc
gtctacattttggcggcttggaaagtcggcgccgtgtatgtgccgctctttaccgcgttt
ggcccacaggcgattgaatatcgcatcaaccattccgaggcgaaagtcctcttgacgaac
aaggaacagcgcgccaaactgccgccgcgggacaacatgccgacattggaacacattttt
gtcattgacggaccgtctcatgatcaagaccagccattttgggaaacgctttcgaaagag
tcgactgagcactcgatcgaagaaacgacggtcgacgatctgctcgcgattcagtatacg
tccggctcgaccgggatgccaaaaggcgccatgtggccgcataacgtgctcatcaacatt
tatccgtatatgcgctatgcgattggcctgcgcgatgacgatgtctttttcggcggggcg
gatccgggctgggcgtacgggctgatcttttgcaccttcgcgccgatggcctttggcgtg
ccgatcgtcttttacgaagggccgtttaagccggagacgtgctattccttgatggaaaaa
taccgggtgaccaatttcgcgtacgccccgaccgcgtaccgggcgatggcggcggccggc
gcggacgtcattcgccgctatcaactgaacgtgcgcgccatgagctcggccggcgagccg
ctcaatccggaagtcatccgctttttccaagagcacgtgggcgttacgatccatgaccat
tatggcttgtcggaaacgttgatgctgatcggaaacttcaacgccgccgagatggaaatc
cggcccggatcgatgggatggccgctgccgggctttgacgtggccctgctcgatgagaat
ggaaccccagtcgccgacggcgaagtcggacaaattgcctttaacaccgactcgatcccc
aacgtctttaaggggtattggaaagaccctgaaaaaaccgccgagcggctcgtcggcaag
tggtttttgaccggcgatttggcgacaaaagacgaagacgggtatttctggttccaagga
cgggcggacgacatcatctcgagcgccggctaccgcatcgggccgtttgaaatcgaaagc
tgcctccttgagcatccggctgtcgtcgaagcagccgccgtcgggaagccggatcccgtc
aaaggggaaatcgtcaaagcgtttgtcgtgctcagagaaggctttgcgccgtcggacgag
ctggccgacgagctgtccttgttcgtcaaaacgcgcttatccaagcatgaatacccgcgc
gaagtcgaatttgtcgccgaactgccgaaaacgccgagcggaaaaatccagcggttcatc
ctgcgcaatcaagaaagggaaaagtcaatcaaggcttaa

DBGET integrated database retrieval system