KEGG   Geobacillus sp. Y412MC52: GYMC52_2829Help
Entry
GYMC52_2829       CDS       T01399                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00010  Glycolysis / Gluconeogenesis
gya00620  Pyruvate metabolism
gya00640  Propanoate metabolism
gya00680  Methane metabolism
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01120  Microbial metabolism in diverse environments
gya01130  Biosynthesis of antibiotics
gya01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC52_2829
   00620 Pyruvate metabolism
    GYMC52_2829
   00640 Propanoate metabolism
    GYMC52_2829
  Energy metabolism
   00680 Methane metabolism
    GYMC52_2829
Enzymes [BR:gya01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GYMC52_2829
Lipid biosynthesis proteins [BR:gya01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GYMC52_2829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADU95204
JGI: GYMC52_2829
UniProt: A0A0E0TEL3
Position
complement(2887631..2889223)
Genome map
AA seq 530 aa AA seqDB search
MRREDLIAPERYNLTSEMERHAAAGPDRIALKWESEQGETKEITYGRLMARANQIGNAFL
SHGLEKGDKVLVMMPRLIETYEVYIGALKAGLVVIPSSEMLRTKDLQYRLVHSEAKAVVA
YAPYTDEFAPIDGIERLTKFVIGEPRDGWIPLEDAMAKESETLEAADTSRDDMAFLSYTS
GTTGNPKGVVHCHGWAYAHLRTAAKNWLCIEEGDLVWATAGPGWQKWIWSPFLSVLGSGA
TGFVYYGRFEPEKYLQLLEKYNINVLCCTPTEYRLMAKVPDIGRYHLSHLHSAVSAGEPL
NREVIDTFAKHFGVEVRDGYGQTENTLLVGVMKGMPIKPGSMGKPTPGNRVEIIDENGEP
CPPGQVGDIAVHIETPALFKYYYKDPERTAMQFRGDYYITGDKARKDEDGYFWFEGRGDD
IIISAGYTIGPFEVEDALVKHPAVKECAVVASPDEVRGHVVKAFVVLRDGVDKDDPSLIP
ALQEHVKQLTAPYKYPRKIEFVDDLPKTASGKIRRVELREREARLAGRSS
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgggaagacttgattgctcccgagcgctacaatttaacatcggaaatggaacgg
catgcggccgccggcccggatcggatcgcgttgaaatgggagagcgagcaaggcgaaacg
aaagagattacatacggccgcttgatggcgcgcgccaaccaaattggaaacgctttctta
tcgcatgggctcgaaaaaggcgataaagtgctcgtcatgatgccgcgcctcattgaaaca
tacgaagtgtatataggggcgctcaaagccgggcttgtcgtcatcccaagctcggagatg
ctgcggacaaaggatttgcaatatcggctcgtccatagcgaagcgaaagcggttgtcgct
tatgcgccgtatacggacgaatttgcgccgattgacggcatcgaacgtttgacgaagttc
gtcatcggggaaccccgggacggatggattccgcttgaagacgccatggccaaagagagc
gaaacgcttgaggcggcggatacctcgcgcgatgatatggcgtttttgtcgtacacatcc
ggcacgaccggcaatccgaaaggggtcgtccattgccatggttgggcgtatgcccacttg
cgcacggctgcgaaaaactggctgtgcattgaagaaggcgacctcgtttgggcgacggcc
ggaccgggatggcaaaaatggatttggagcccgtttttatcggtgctcggctcgggggcg
accggtttcgtctactacggccgctttgagccggaaaaatatttgcagctattggaaaaa
tacaacatcaatgtgctgtgctgcacgccgaccgagtatcgtttgatggcgaaagtgccg
gacatcggccgctatcatctatctcatttgcacagcgccgtgtccgccggagagccgctc
aaccgcgaagtgatcgacacgtttgccaagcatttcggcgtcgaagtgcgcgacggctac
ggccagacagaaaacacgctgcttgtcggcgtcatgaaaggaatgcccatcaagccgggt
tcgatggggaaaccgacgccaggcaaccgcgtcgaaattatcgatgaaaacggcgagccg
tgcccgcccggacaagtcggcgacatcgccgtccatatcgagacgccggcgctgtttaag
tattattacaaagatccggagcggacagcgatgcagttccgcggcgactactacattacg
ggagacaaagcgcgcaaagacgaagacggctatttctggtttgaaggccgcggggatgac
atcatcatcagcgccggctatacgatcggcccgtttgaagtcgaagacgcgcttgtcaag
cacccagccgtaaaagagtgcgccgtcgtcgccagtccggatgaagtgcgcggccatgtt
gtcaaagcgtttgtcgtgctgcgcgacggggtcgacaaagacgatccgtctctgattccg
gccctgcaagaacatgtgaaacagttgacggcgccgtacaaatacccgcgcaaaatcgag
tttgtcgacgatttgccgaaaacggcgtccggaaaaatccgccgcgtcgagctgcgcgag
cgggaagcccgccttgccggccggtcgtcgtaa

DBGET integrated database retrieval system