KEGG   Geobacillus sp. Y412MC52: GYMC52_2997Help
Entry
GYMC52_2997       CDS       T01399                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00500  Starch and sucrose metabolism
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GYMC52_2997
Enzymes [BR:gya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     GYMC52_2997
Exosome [BR:gya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GYMC52_2997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ADU95362
JGI: GYMC52_2997
UniProt: A0A0E0TG37
Position
complement(3037420..3039462)
Genome map
AA seq 680 aa AA seqDB search
MYGHHFASERMRSSLIAANPTDLEVYLFHEGRLYQSYELFGAHVIRDGGAVGTRFCVWAP
HAREVRLVGSFNDWNGANSPLTKVNDEGVWTIVVPENLEGHLYKYEIITPDGRVLLKADP
YAFYSELRPHTASIVYDLKGYEWNDSSWQRKKRRKRIYDQPMVIYELHFGSWKKKPDGRF
YTYREMADELIPYVLERGFTHIELLPLVEHPLDRSWGYQGTGYYSVTSRYGTPHDFMYFV
DRCHQAGLGVIIDWVPGHFCKDAHGLYMFDGAPTYEYANEKDRENYVWGTANFDLGKPEV
RSFLISNALFWLEYYHVDGFRVDAVANMLYWPNNDRLYENPYAVEFLRQLNEAVFAYDPN
VLMIAEDSTDWPRVTAPTYDGGLGFNYKWNMGWMNDMLKYMETPPHERKYAHNQVSFSLL
YAYSENFILPFSHDEVVHGKKSLLNKMPGSYEEKFAQLRLLYGYMMAHPGKKLLFMGSEF
AQFDEWKFEGELDWVLFDFELHRKMDEYVKQLIACYKRYKPFYELDHDPRGFEWIDVHNA
EQSIFSFVRRGKKDGDLLVIVCNFTNQAYDDYKVGVPLLAPYREVLNSDAAEFGGSGHVN
GKRLPAFSEPFHGKPYHVRMTIPPFGISILRPVQKRGERKQNEEEVHRHVIGRRARKPAS
LADEKHRETSRAVWGEVPDH
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
gtgtatggccatcattttgcttcggaaaggatgcgatccagcttgattgcggcgaatccg
acagatttagaagtgtatttgtttcatgaaggccgtttgtatcaaagttatgagctgttc
ggcgctcatgtcatccgcgacggcggagcggtcggcactcgcttttgcgtgtgggcgccc
catgcgcgggaagtccgtcttgtcggcagtttcaacgattggaatggggcgaattccccc
ctgacgaaggtgaacgacgaaggggtatggacgatcgttgttccagaaaacttggaaggg
catctctataaatatgagatcatcacaccggatggccgtgttctgttgaaagccgacccg
tacgccttttactccgaattgcgccctcataccgcctcgattgtctacgatttgaaagga
tacgagtggaatgattcatcttggcagcggaagaaacggcgaaagcggatttatgaccaa
ccgatggtcatttatgaacttcatttcggttcgtggaaaaagaaaccggacggccgcttt
tatacgtaccgtgagatggccgacgaactcattccgtacgtgctggagcgcggatttacg
cacattgagctgcttccgcttgtcgagcatccgctcgatcgttcgtggggatatcaaggg
accggctattattcggtgacaagccgctatggcacgccgcacgatttcatgtatttcgtc
gaccgctgccatcaagcggggcttggcgtcatcatcgactgggtgccggggcatttttgc
aaggacgcccacgggctgtacatgtttgacggcgcaccgacgtatgaatacgcgaatgaa
aaagaccgagaaaattacgtctgggggacggcgaattttgacttgggcaagccggaagtg
cgcagttttctgatctccaatgcgttgttttggctggagtattaccatgtggacgggttt
cgcgtcgatgcggtcgccaatatgctttattggccgaacaacgaccggctctatgaaaat
ccgtatgcggtcgagtttttgcgccagttgaatgaggcggtgtttgcctatgacccgaac
gtcttgatgatcgctgaagattcgaccgactggcctcgggtgaccgcgccgacgtacgat
ggcggccttgggtttaactacaagtggaacatgggctggatgaacgacatgctgaagtat
atggaaacgccgccgcatgagcggaaatacgcccataaccaagtcagtttttccctcctt
tatgcgtattcggaaaatttcattttgccattttcccatgatgaagttgtgcatggcaaa
aaatcgctgctcaataaaatgcctgggtcgtacgaagagaagttcgcccagctgcgccta
ttgtatggctacatgatggcccaccctgggaaaaagctgctgtttatgggcagtgagttt
gcccagtttgatgaatggaagtttgagggagagctcgactgggtgctgttcgattttgaa
ttgcaccggaaaatggacgaatatgtgaagcagctgatcgcctgctataaacggtataag
ccgttttacgagcttgatcatgatccgagggggtttgaatggattgacgttcataatgcc
gagcaaagcattttctcgttcgtccgccgcgggaaaaaagacggcgatctattggtaatt
gtttgcaatttcacaaatcaagcgtatgacgattacaaagtcggcgtgccgcttttggcg
ccgtaccgcgaagtgcttaacagcgatgcagcggagtttggcggttcgggacatgtcaac
gggaagcggcttcccgctttcagtgagccgtttcatggaaaaccgtaccatgtgcgcatg
acgattccgccgtttggcatttccattttgcggccagtgcaaaaacgaggggagagaaag
cagaatgaagaagaagtgcatcgccatgttattggccggcgggcaaggaagccggcttcg
ctcgctgacgaaaaacatcgcgaaaccagccgtgccgtttggggggaagtaccggatcat
tga

DBGET integrated database retrieval system