KEGG   Geobacillus sp. Y412MC52: GYMC52_3163Help
Entry
GYMC52_3163       CDS       T01399                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00010  Glycolysis / Gluconeogenesis
gya00051  Fructose and mannose metabolism
gya00562  Inositol phosphate metabolism
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01120  Microbial metabolism in diverse environments
gya01130  Biosynthesis of antibiotics
gya01200  Carbon metabolism
gya01230  Biosynthesis of amino acids
Module
gya_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gya_M00002  Glycolysis, core module involving three-carbon compounds
gya_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC52_3163
   00051 Fructose and mannose metabolism
    GYMC52_3163
   00562 Inositol phosphate metabolism
    GYMC52_3163
Enzymes [BR:gya01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GYMC52_3163
Exosome [BR:gya04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GYMC52_3163
  Exosomal proteins of bladder cancer cells
   GYMC52_3163
  Exosomal proteins of melanoma cells
   GYMC52_3163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADU95521
JGI: GYMC52_3163
UniProt: A0A0E0TFX4
Position
complement(3191918..3192679)
Genome map
AA seq 253 aa AA seqDB search
MRKRIIAGNWKMHKTLAEAVQFVEDVKGHVPPADEVDSVVCAPFLFLDRLVQAADGTDLK
IGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRG
LTPIVCCGESLEEREAGQTNAVVASQVEKALAGLTPDQVKQAVIAYEPIWAIGTGKSSTP
EDANDVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQEHIDGALVGGASLEP
ASFLQLVEAGRYE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacgcatcattgcaggcaactggaaaatgcataaaacattggcggaagctgtt
caatttgtcgaggacgtaaaagggcacgtgccgccggccgacgaagtggattccgttgtt
tgcgcgccgtttctctttttagatcggttggtgcaagcggcagacggcacggatttaaaa
atcggggcgcaaacgatgcactttgccgaccaaggggcgtacacaggcgaagtgagcccg
gtcatgctcaaagatctcggcgtcacgtacgtcatcctcggccattcggagcgccggcaa
atgttcgcggaaacagatgagaccgtgaacaaaaaagtgttggccgccttcacccgcggc
ttgacgccgattgtttgctgcggcgaatcgcttgaggagcgggaagcggggcagacgaac
gccgttgtcgcctcgcaagtggaaaaagcgctcgccggcttgacgccggatcaagtgaag
caagcggtcatcgcttacgagccgatttgggcgatcggcacgggcaaatcgtcgacgccg
gaagatgcgaacgacgtgtgcggccatatccgttcggtcgtttcgcgcttgtttggcccg
gaggcggcggaagcgatccgcatccaatacggcggcagcgtcaaaccggacaacatccgc
gacttcttggcgcaagaacatatagacggcgccttagtcggcggggcgagcctcgagccg
gcttcattcttgcaattggtggaggcggggcgctatgagtaa

DBGET integrated database retrieval system