KEGG   Geobacillus sp. Y412MC52: GYMC52_3163Help
Entry
GYMC52_3163       CDS       T01399                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYMC52_3163
   01230 Biosynthesis of amino acids
    GYMC52_3163
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC52_3163
   00051 Fructose and mannose metabolism
    GYMC52_3163
   00562 Inositol phosphate metabolism
    GYMC52_3163
Enzymes [BR:gya01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GYMC52_3163
Exosome [BR:gya04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GYMC52_3163
  Exosomal proteins of bladder cancer cells
   GYMC52_3163
  Exosomal proteins of melanoma cells
   GYMC52_3163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(3191918..3192679)
Genome map
AA seq 253 aa AA seqDB search
MRKRIIAGNWKMHKTLAEAVQFVEDVKGHVPPADEVDSVVCAPFLFLDRLVQAADGTDLK
IGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRG
LTPIVCCGESLEEREAGQTNAVVASQVEKALAGLTPDQVKQAVIAYEPIWAIGTGKSSTP
EDANDVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQEHIDGALVGGASLEP
ASFLQLVEAGRYE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacgcatcattgcaggcaactggaaaatgcataaaacattggcggaagctgtt
caatttgtcgaggacgtaaaagggcacgtgccgccggccgacgaagtggattccgttgtt
tgcgcgccgtttctctttttagatcggttggtgcaagcggcagacggcacggatttaaaa
atcggggcgcaaacgatgcactttgccgaccaaggggcgtacacaggcgaagtgagcccg
gtcatgctcaaagatctcggcgtcacgtacgtcatcctcggccattcggagcgccggcaa
atgttcgcggaaacagatgagaccgtgaacaaaaaagtgttggccgccttcacccgcggc
ttgacgccgattgtttgctgcggcgaatcgcttgaggagcgggaagcggggcagacgaac
gccgttgtcgcctcgcaagtggaaaaagcgctcgccggcttgacgccggatcaagtgaag
caagcggtcatcgcttacgagccgatttgggcgatcggcacgggcaaatcgtcgacgccg
gaagatgcgaacgacgtgtgcggccatatccgttcggtcgtttcgcgcttgtttggcccg
gaggcggcggaagcgatccgcatccaatacggcggcagcgtcaaaccggacaacatccgc
gacttcttggcgcaagaacatatagacggcgccttagtcggcggggcgagcctcgagccg
gcttcattcttgcaattggtggaggcggggcgctatgagtaa

DBGET integrated database retrieval system