KEGG   Geobacillus sp. Y412MC52: GYMC52_3184Help
Entry
GYMC52_3184       CDS       T01399                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GYMC52_3184
  Amino acid metabolism
   00340 Histidine metabolism
    GYMC52_3184
Enzymes [BR:gya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     GYMC52_3184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3210206..3211480)
Genome map
AA seq 424 aa AA seqDB search
MKIERIRGGVSLRRTIESGTEEQRRVVLDIISNVRARGDEALKEYTERFDGVKLDSLKVT
EEEMKRAHAAMDAEMLEIIRQAAANIRDYHERQKRESWWMTKEDGTILGQKVTPLDAVGL
YVPGGTAAYPSSVLMNVIPAQVAGVKRIVITSPPNKDGTLPAGVLAAAYELGVTEIYKVG
GAQAIAALAYGTETIRPVDKIFGPGNIYVALAKREVFGHVAIDMIAGPSEIVVLADETAR
PDEIAADLLSQAEHDVRASAILVTPSMKLALAVASEVERQLETLPRRDIAQAALENYGAI
YVTETLEEAVDVVNELAPEHLEVMTAEPLALFGRLRHAGAMFFGRFSSEPVGDYFAGPNH
VLPTNGTARFSSGLGVDEFVKKSSVIVYSEAALKQHGEKIAAFARLEGLEAHARAIEVRL
EKGE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgaacggatccgaggcggcgtttcgctgcggcgcacgattgaaagcggaacg
gaggagcagcggcgcgtggtgctggatatcatttccaacgtgcgcgcccgcggcgatgaa
gcgctgaaagaatacacggaacggtttgacggcgtcaagctggattcgctcaaggtgacg
gaagaggaaatgaagcgcgcgcatgcggcgatggacgcggagatgctggagatcattcgc
caagcggcggcgaacattcgcgactaccatgagcggcaaaagcgcgaatcatggtggatg
acgaaagaagacggcacaattctcggacaaaaggtgacgccgctcgatgcggtcgggttg
tacgtgccaggcgggacggccgcttatccgtcgtctgtgctgatgaacgttattcccgca
caagtggcgggggtgaaacggattgtcatcacctcgccgccaaacaaagacggcacgctc
ccggctggggtgctggccgccgcctatgaactcggcgtgacggaaatttacaaagtcggc
ggcgcgcaggcgatcgccgcgcttgcttacgggacggaaacgattcggccggttgacaaa
attttcgggccgggcaatatttatgtggcattggcgaagcgggaagtgttcgggcatgtg
gcgatcgacatgatcgcggggccgagcgaaattgtcgtgctggcggatgaaacggcccga
ccggatgagattgcggcggatttgttgtcgcaagccgagcatgacgtgcgggcgtcggcc
attttggtgacgccgtcgatgaaattggcgctggcggtggcgagcgaagtcgaacggcag
cttgaaacgctgccgcgccgcgacattgcccaagcggcgcttgagaactacggcgccatt
tacgtcaccgagacgcttgaggaagcggtggatgttgtgaacgaactggcgccggagcat
ttggaagtgatgacggcagaaccgctcgcgcttttcggccggctccgccatgcgggagcg
atgtttttcggccgcttcagctccgagccggtcggcgactatttcgccgggccgaaccac
gtgctgccgacgaacggtacggcaaggttttcaagcggtctcggcgtcgatgagtttgtg
aaaaaatcaagcgtgattgtttacagtgaagccgcattgaaacaacatggagaaaaaatc
gccgcctttgcccgcctcgaggggctggaggcgcacgcgcgcgccattgaggtgcggctc
gagaaaggggaatga

DBGET integrated database retrieval system