KEGG   Geobacillus sp. Y412MC52: GYMC52_3363Help
Entry
GYMC52_3363       CDS       T01399                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GYMC52_3363
Enzymes [BR:gya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GYMC52_3363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3400104..3400997)
Genome map
AA seq 297 aa AA seqDB search
MNKPTITVIGSINMDLVTVAVRFPNQGETILGEQFLTTPGGKGANQAVAAARLGADVRMI
GAVGDDAFGQELIRSLQNEGVSVDYVKPVTYEHTGIASITISERDNRIIVVPGANHALTP
EDLDPYESVIAESDVCLLQLEIPLPVVERAVSIAHRHGVRVIVNPAPAQPLPLVVLEQAS
FLTPNEHERAILFDKMDEEAFADKLIVTEGAKGVRIWQDGQERLIPSFHVPVVDTTGAGD
TFNGALAVALAEGKPLDEACRFANAAAALSVTKLGAQAGMPRRQEVESFLSRQKESH
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaaccaaccattacggtgatcggcagcatcaacatggacttagtcactgtggcg
gtgcgctttcccaatcaaggagagacgattttaggcgaacagtttctcaccactcctggc
ggcaaaggggcgaaccaggcggtggccgccgcccgcctcggcgccgatgtacggatgatt
ggcgcggtgggggatgatgcgtttggtcaagagctcatccgttcgttacaaaatgaaggc
gtttccgtcgattatgtgaaaccggttacatatgaacatacaggcatcgcttccattacg
atttctgagcgggacaatcgcattattgtcgtccccggggcgaatcatgcgcttacgccg
gaggatctggatccatatgaatccgtgatcgccgaaagcgatgtgtgcttactgcagctc
gagattccgcttcccgttgtggaacgagcggtttcgatcgctcatcgccatggcgtgcgc
gtcatcgtgaacccagctccagcccagccgctgccgctcgtggtgcttgagcaggcgagt
ttcttgacgccgaatgaacatgaacgggccattttgtttgacaagatggacgaagaagcg
tttgccgataagctgattgtcaccgaaggggcaaaaggggtgcgcatttggcaagatgga
caagaacggctcattccaagttttcacgttcccgtcgtggatacgacgggcgcgggcgat
acgtttaacggtgcgcttgccgtggcgctggcggaagggaagccgcttgatgaagcgtgt
cggtttgccaatgcggcggcggccttgtcggtgacgaaacttggggcgcaagctgggatg
ccgagacggcaagaggtcgaatcatttttgtccagacagaaggagagtcactga

DBGET integrated database retrieval system