KEGG   Geobacillus sp. Y412MC52: GYMC52_3473Help
Entry
GYMC52_3473       CDS       T01399                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00520  Amino sugar and nucleotide sugar metabolism
gya00550  Peptidoglycan biosynthesis
gya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GYMC52_3473
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GYMC52_3473
Enzymes [BR:gya01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     GYMC52_3473
Peptidoglycan biosynthesis and degradation proteins [BR:gya01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   GYMC52_3473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase TadZ_N
Motif
Other DBs
NCBI-ProteinID: ADU95817
JGI: GYMC52_3473
UniProt: A0A0E0THC8
Position
complement(3504348..3505634)
Genome map
AA seq 428 aa AA seqDB search
MDKMKIIGGDRLRGTIKVSGAKNSAVALIPAAILADSPVTIEGLPDISDVHILGSLIEEI
GGSFSFDGKEAVIDPTNMVSMPLPNGKVKKLRASYYLMGAMLGRFKKAVVGLPGGCHLGP
RPIDQHIKGFEALGATVTNEQGAIYLRAEELRGARIFLDVVSVGATINIMLAAVRAKGRT
IIENAAKEPEIIDVATLLSNMGAKIKGAGTDVIRIDGVETLSGCRHAIIPDRIEAGTYMI
AAAATNGEVVVDNVIPQHVESLTAKLREMGVRVETGEDQILVCGTDVLKAVDVKTLVYPG
FPTDLQQPFTALLTKANGTSVVTDTIYSARFKHVDELRRMNANVKVEGRSAIVTGPVKLQ
GAKVKASDLRAGAALVIAGLMAEGVTEITGVEHIDRGYSNLVEKLSDIGATIWREKMTDE
EIEQVKNA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggataaaatgaaaattatcggcggagatcggctgcggggaacgatcaaagtgagcggt
gcgaaaaacagcgcggtcgctttgattcctgcagcgattttggccgattcgccggtgacg
atcgaggggttgccggacatttccgacgtgcacattttaggaagcttgatcgaagaaatc
ggcggctcgttttcgtttgacggcaaagaggcggtcatcgacccaacgaatatggtgtcc
atgccgcttccgaatgggaaggtgaaaaagctgcgcgcctcctactatttgatgggggcg
atgcttggccgattcaaaaaagcggttgtcggcttgccgggcggatgtcatctcggtccg
cgcccgattgaccagcatatcaaagggtttgaggcgctgggcgccaccgtaacgaacgag
cagggcgccatttatttgcgcgcggaagaactgcgcggagcccgcatttttttggacgtc
gtcagcgtcggcgcgacgatcaacatcatgctggcggcggtgcgcgccaaagggcggacg
attatcgaaaatgcggcgaaagagccggaaatcatcgatgtagcgacattgctttcgaat
atgggcgcgaaaatcaaaggagccggcaccgatgtgatccgcattgacggcgtcgaaaca
ttatcgggttgccgccatgccatcatcccggatcggatcgaagccgggacgtacatgatt
gccgccgcggccaccaatggcgaagtcgtcgtcgacaacgtcatcccgcagcacgttgaa
tcgctgacggccaaattgcgcgaaatgggggtgcgcgtggagacgggggaagatcaaatt
ctcgtctgcggcaccgacgttttgaaagcggttgacgtcaagacgctcgtctatccgggc
ttcccaactgatctgcagcagccgtttaccgcgctgctgacaaaagccaacggcacaagc
gtcgtcaccgacacgatttacagcgcccgcttcaagcatgtcgatgaattgcggcgcatg
aacgccaatgtaaaagtcgaaggccgctcagccatcgtcaccggccccgtcaaactgcaa
ggggcgaaagtgaaggcaagcgatttgcgcgccggggcggcgcttgtcattgccgggctg
atggccgaaggagtgacggagatcaccggcgtcgagcatatcgaccgcggctacagcaac
ctcgtcgaaaaactgtctgacatcggcgccaccatttggcgcgaaaaaatgaccgatgaa
gaaatcgagcaagtgaaaaacgcgtaa

DBGET integrated database retrieval system