KEGG   Geobacillus sp. Y412MC61: GYMC61_0069Help
Entry
GYMC61_0069       CDS       T01101                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GYMC61_0069
Enzymes [BR:gyc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     GYMC61_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
82035..82886
Genome map
AA seq 283 aa AA seqDB search
MTTSMRPLRLQCRGHELDLNKKTLIMGIVNVTPDSFSDGGRFYDVENAVKHAKRLVAEGA
DIIDIGGESTRPGADPVPLDEELRRVIPAVKAIAKAVSVPISIDTYKAEVARQAMEAGAH
IINDVWGAKADPDMARVAATYGAPIILMHNRRDMAYRDLISDMIADLKESIRIVKEAGVK
DENIILDPGIGFAKTVEHNLEVMRRLDEFAALGYPLLLGTSRKRFIGHVLGVPVEERVEG
TGATVCLGIMKGVHIVRVHDVLPIARMAKMMDAMLGKGESGHR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatcgatgcgccctcttcggcttcaatgccgcgggcatgagcttgacttaaac
aaaaaaacgttgatcatgggcattgtcaacgtcacgcccgattcgttttccgacggcggc
cggttttacgacgtggaaaacgcggtcaagcacgcgaagcggctcgtggcggaaggagca
gacatcattgacatcggcggtgaatcaactcgtccgggggcggatccagtgccgcttgat
gaagaattgcgccgcgtcattccggcggtaaaagcgattgctaaggcggtgagtgtgccg
atctcaattgacacgtacaaagcggaagtggcgcggcaagccatggaggccggggcgcac
atcatcaacgacgtttggggagccaaggcggaccctgatatggcccgcgtcgccgccacg
tacggcgcgccgatcattttaatgcacaaccgccgcgatatggcctatcgcgatttgatt
tccgacatgatcgccgatttgaaagaaagcattcgcattgtcaaagaggcgggtgtgaaa
gatgagaacattattttagatccagggatcggcttcgccaagacggtcgagcataacttg
gaggtgatgcggcgccttgatgaatttgccgctctcggctatccgcttttgcttggcacg
tcgcgcaaacgatttatcggccatgtgctcggcgtgcctgtcgaggagcgggtcgaagga
acaggagcgaccgtttgtctcggcatcatgaaaggggtgcacattgtccgagtccatgat
gtattgccgattgcccgcatggccaaaatgatggatgctatgcttgggaagggagagagc
ggtcatcgataa

DBGET integrated database retrieval system