KEGG   Geobacillus sp. Y412MC61: GYMC61_0149Help
Entry
GYMC61_0149       CDS       T01101                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GYMC61_0149
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GYMC61_0149
Enzymes [BR:gyc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     GYMC61_0149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
160404..161303
Genome map
AA seq 299 aa AA seqDB search
MKPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLEHLHYDIEDLGDIPIGKAERLHEQ
GDSRLRNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIW
YDAHGDVNTEETSPSGNIHGMPLAASLGFGHPALTQIGGYSPKIKPEHVVLIGVRSLDEG
EKKFIREKGIKIYTMHEVDRLGMTRVMEETITYLKERTDGVHLSLDLDGLDPSDAPGVGT
PVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKLI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaatttcaattatcggggttccgatggatttagggcagacacgccgcggcgtt
gatatggggccgagcgcaatgcgttatgcaggcgtcatcgaacgtctggaacatcttcat
tacgatattgaagatttgggagatattccgattgggaaagcagagcggttgcacgagcaa
ggagattcacggttgcgcaatttgaaagcggttgcggaggcgaatgagaaactcgcggcg
gcggttgaccaagtcgttcagcgggggcgcttcccacttgtgctgggcggcgaccatagc
atcgccattggcacgctcgccggggtggcgaaacattatgagcggcttggagtgatctgg
tatgacgcgcacggcgacgtcaacaccgaggaaacgtcgccgtctggaaacattcatggc
atgccgctggcggcgagcctcgggtttggccatccggcgctgacgcaaatcggcggatac
agccccaaaatcaagccggaacatgtcgtgttgatcggcgtccgttcccttgatgaaggg
gagaagaagtttattcgcgaaaaaggaatcaaaatttacacgatgcatgaggttgatcgg
ctcggaatgacaagggtgatggaagaaacgatcacctatttaaaagaacgaacggatggc
gttcatttgtcgcttgacttggatggccttgacccaagcgacgcaccgggagtcggaacg
cctgtcattggaggattgacataccgcgaaagccatttggcgatggagatgctggccgaa
gcacaaatcatcacttcagcggaatttgtcgaagtgaacccgatcttggatgagcggaac
aaaacagcatcagttgctgtagcgctgatggggtcgttgtttggtgaaaagctcatttaa

DBGET integrated database retrieval system