KEGG   Geobacillus sp. Y412MC61: GYMC61_0149Help
Entry
GYMC61_0149       CDS       T01101                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc00220  Arginine biosynthesis
gyc00330  Arginine and proline metabolism
gyc01100  Metabolic pathways
gyc01110  Biosynthesis of secondary metabolites
gyc01130  Biosynthesis of antibiotics
gyc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    GYMC61_0149
   00330 Arginine and proline metabolism
    GYMC61_0149
Enzymes [BR:gyc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     GYMC61_0149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACX76849
JGI: GYMC61_0149
Position
160404..161303
Genome map
AA seq 299 aa AA seqDB search
MKPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLEHLHYDIEDLGDIPIGKAERLHEQ
GDSRLRNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIW
YDAHGDVNTEETSPSGNIHGMPLAASLGFGHPALTQIGGYSPKIKPEHVVLIGVRSLDEG
EKKFIREKGIKIYTMHEVDRLGMTRVMEETITYLKERTDGVHLSLDLDGLDPSDAPGVGT
PVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKLI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaatttcaattatcggggttccgatggatttagggcagacacgccgcggcgtt
gatatggggccgagcgcaatgcgttatgcaggcgtcatcgaacgtctggaacatcttcat
tacgatattgaagatttgggagatattccgattgggaaagcagagcggttgcacgagcaa
ggagattcacggttgcgcaatttgaaagcggttgcggaggcgaatgagaaactcgcggcg
gcggttgaccaagtcgttcagcgggggcgcttcccacttgtgctgggcggcgaccatagc
atcgccattggcacgctcgccggggtggcgaaacattatgagcggcttggagtgatctgg
tatgacgcgcacggcgacgtcaacaccgaggaaacgtcgccgtctggaaacattcatggc
atgccgctggcggcgagcctcgggtttggccatccggcgctgacgcaaatcggcggatac
agccccaaaatcaagccggaacatgtcgtgttgatcggcgtccgttcccttgatgaaggg
gagaagaagtttattcgcgaaaaaggaatcaaaatttacacgatgcatgaggttgatcgg
ctcggaatgacaagggtgatggaagaaacgatcacctatttaaaagaacgaacggatggc
gttcatttgtcgcttgacttggatggccttgacccaagcgacgcaccgggagtcggaacg
cctgtcattggaggattgacataccgcgaaagccatttggcgatggagatgctggccgaa
gcacaaatcatcacttcagcggaatttgtcgaagtgaacccgatcttggatgagcggaac
aaaacagcatcagttgctgtagcgctgatggggtcgttgtttggtgaaaagctcatttaa

DBGET integrated database retrieval system