KEGG   Geobacillus sp. Y412MC61: GYMC61_0195Help
Entry
GYMC61_0195       CDS       T01101                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc00010  Glycolysis / Gluconeogenesis
gyc00052  Galactose metabolism
gyc00500  Starch and sucrose metabolism
gyc00520  Amino sugar and nucleotide sugar metabolism
gyc00521  Streptomycin biosynthesis
gyc01100  Metabolic pathways
gyc01110  Biosynthesis of secondary metabolites
gyc01120  Microbial metabolism in diverse environments
gyc01130  Biosynthesis of antibiotics
gyc01200  Carbon metabolism
Module
gyc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gyc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC61_0195
   00052 Galactose metabolism
    GYMC61_0195
   00500 Starch and sucrose metabolism
    GYMC61_0195
   00520 Amino sugar and nucleotide sugar metabolism
    GYMC61_0195
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GYMC61_0195
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GYMC61_0195
Enzymes [BR:gyc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GYMC61_0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ACX76894
JGI: GYMC61_0195
Position
204041..204994
Genome map
AA seq 317 aa AA seqDB search
MEPWLVGIDLGGTTIKMAFVTTEGDIVHKWEIPTNTANRGEHIVADIARSLEKTLGQLGG
AKERLLAAGIGAPGPVEEETGMLYETVNIGWTNYPLKQRLEEATGLPVSVDNDANLAALG
EMWKGAGGGARHLLFVTLGTGVGGGVIANGAIVRGINGAGGEIGHMTMIPDGGARCNCGK
TGCLETIASATGIVRIAKEKLTADERPSELRNGDVTAKAVFDAAKAGDALALEVVDEATY
YLGWALANAANVTNPEKIVIGGGVSKAGDMLVERVAAHFRRFAFPRVAAGAKLVLATLGN
DAGVIGAAWLAKELVGA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggaaccatggttggtaggcattgacctcgggggcacgacaatcaaaatggcgtttgtc
accaccgagggtgacatcgtgcacaaatgggaaattccgacgaacaccgccaatcgcggt
gagcatatcgtcgctgacattgcccgatcgcttgaaaagacgctcggccagctcggcgga
gcgaaagagaggctgcttgccgccggcatcggcgcccccggaccggtcgaagaggaaacc
ggcatgttgtatgagacggtcaatatagggtggacgaattatccattaaagcaacggctg
gaagaggcgacggggctgcccgtttcggtcgataatgatgccaatctcgccgcgcttggc
gaaatgtggaaaggagcagggggaggagcgcgacatttgttgtttgtgacgcttggcacc
ggcgttggcggcggtgtgattgccaacggagccattgtgcgcggcataaacggcgccggc
ggagagatcggacatatgacgatgatccctgatggcggcgcccgttgcaactgcggcaaa
accggatgtttggaaacgattgcgtccgccaccggcatcgtgcggatcgccaaggagaaa
ttgaccgcagatgagcgtccgagtgagcttcgcaacggggatgtgacggccaaagcggtg
tttgacgccgccaaagcgggcgatgcgctggcattggaagtggtcgatgaagcaacgtac
tatcttggttgggcgttggcgaatgccgccaatgtgacgaacccggagaaaatcgtgatc
ggcggcggcgtgtccaaggcgggtgacatgcttgtcgagcgcgtggccgcccatttccgc
cgcttcgcgttcccgcgcgtcgccgctggggcgaagcttgttttagcgacgcttggcaac
gatgccggcgtcatcggcgccgcctggctggcgaaagagcttgtcggcgcgtaa

DBGET integrated database retrieval system