KEGG   Geobacillus sp. Y412MC61: GYMC61_0345Help
Entry
GYMC61_0345       CDS       T01101                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gyc00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
364826..366193
Genome map
AA seq 455 aa AA seqDB search
MSQQRKSIIPDNFLWGGAVTSFQTEGAWNEGGKGLSIVDARPIPKGHSDWKVAVDFYHRY
KEDIALFKELGFTAYRTSIAWTRIFPDGEGEPNEAGLAFYDAVFDELRANGIEPVITLYH
FDLPLALAKTYNGFASRKVVDLFERYARTIFERYRGKVNYWLTFNEQNLVLEQPHLWGAI
CPEDEDPEAFAYCVCHNVFIAHAKAVKALREIAPEAKIGGMVTYLTTYPATCRPEDALAN
VQAKELFIDFFFDVFARGAYPRYVTNRLEKKGICLPLEAGDEELLRSQTVDFLSFSYYQS
QIVRHQEQDERIIKGLEPNPYLPKTKWGWAIDPIGLRIALKDVYARYEMPIFITENGIGL
EEELNEDGTVEDDERIDYLRRHIEQMKMAMEEGVEVIGYLMWGATDLLSSQGEMRKRYGV
IFVNRDDENLRDLKRYKKKSFYWFQRIIRTNGEEL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacagcgtaaatcgatcatccccgacaactttttatggggcggggcggtgacg
tcgtttcagacggaaggggcgtggaacgaaggcggcaaagggctgtcgatcgttgatgcg
cgcccgattccaaaagggcattccgactggaaagtggcggtcgatttttaccatcgctac
aaagaagacatcgctttgttcaaggagctcggctttaccgcctaccggacgagcatcgct
tggacgcgcatttttccggacggggaaggggagccgaatgaagcgggcttggcgttttat
gacgccgtgtttgatgaattgagagcgaacggcatcgagccggtcattacgctgtaccat
tttgatttgccgctggcgttggcgaaaacgtacaacggctttgcctcgcggaaagtcgtc
gacttgtttgagcggtacgcgcgcaccatatttgagcgttaccgcgggaaagtgaactat
tggctgacgttcaacgaacaaaatttagtgctcgaacaaccgcatttatggggggcgatc
tgcccggaagacgaagacccggaagcgtttgcctactgcgtctgtcataatgtgttcatc
gcccacgcgaaagccgtgaaggcgctgcgcgaaatcgctcccgaggcgaagatcggcggg
atggtgacgtatttgacgacgtatccggcgacatgccggccggaagacgctttggcgaac
gtgcaggcgaaagagctgttcattgatttcttctttgatgtgtttgcccgcggcgcctat
ccgcgttatgtgaccaaccggcttgagaaaaaaggaatctgcctgccgctcgaagcgggg
gatgaggagttgctccgttcgcagacggtcgactttttgtcgttcagctactatcaaagc
caaatcgtccgccatcaggaacaggatgagcggatcatcaaagggcttgaaccgaatccc
tatttgccaaagacgaaatggggctgggcgatcgatccgatcggtttgcggattgcctta
aaagacgtgtacgcccgttacgaaatgccgattttcatcaccgaaaacggcatcgggctt
gaggaggagctgaatgaggacggcacggtcgaagatgatgagcggatcgactatttgcgc
cgccatatcgaacaaatgaagatggccatggaagaaggggtcgaggtgatcggctatttg
atgtggggggcgacggatctattaagctcgcaaggggagatgcgcaagcgctacggcgtc
attttcgtcaaccgcgacgacgagaacttgcgcgatttgaagcgctataagaaaaaaagt
ttttattggttccagcgcatcattcgcacgaacggggaagagctgtaa

DBGET integrated database retrieval system