KEGG   Geobacillus sp. Y412MC61: GYMC61_0480Help
Entry
GYMC61_0480       CDS       T01101                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GYMC61_0480
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYMC61_0480
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GYMC61_0480
Enzymes [BR:gyc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GYMC61_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
482946..484163
Genome map
AA seq 405 aa AA seqDB search
MMERVPNEYGRFGDFGGKFVPETLMLPLEEIEAELDKALADESFKQEYIRILQHYSGRPT
PLTFAPNLTRQVGGAKIYLKREDLNHTGAHKINNAIGQALLAKRMGKKKLIAETGAGQHG
VAAATVAAHFGMDCIVFMGEEDIKRQELNVFRMKLLGAEVVPVSSGNRTLKDATNEAIRY
WVAHCDDHFYMIGSVVGPHPYPKMVREFQRVIGDEAKEQFLAREGKLPDVIVACVGGGSN
AIGMFYPFLQDDVRLVGVEAAGKGIDTPHHAATITKGTKGVIHGAMTYLLQDEYGQILEP
YSISAGLDYPGVGPEHAYLASIGRVRYESATDDEAVAAFQLLAQTEGIIPAIESAHAVAK
AVELAREMPPDETVLICLSGRGDKDVQTMMRHLGAREGEDIATVR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgatggaacgcgttccgaatgaatacggccggtttggcgatttcggcggcaagtttgtc
cctgagacgctcatgcttccgcttgaggaaatcgaagcggagcttgacaaagcgcttgcc
gatgaatcgttcaaacaagaatacatccgcattttgcagcattactccggtcgcccgacc
ccgctcacgttcgcgccgaatttgacacggcaagtcggcggcgcgaaaatttatttaaag
cgcgaagatttaaaccatacgggcgcccataaaatcaacaacgcgatcggccaggcgctt
ttggcaaaacggatgggcaagaaaaagctgatcgctgaaaccggagccggccagcacggc
gtcgccgcggcgacggtggccgcccatttcggcatggattgcatcgtttttatgggcgaa
gaagacatcaagcggcaggagctgaacgtgtttcgcatgaaactgttgggcgccgaagtc
gtgccggtgtcaagcggcaaccgaacgttgaaagatgcgacgaacgaagcgattcgctat
tgggtcgcccactgcgacgaccatttttacatgatcggctcggtcgtcggtccgcatccg
tacccgaaaatggtgcgcgagtttcagcgcgtgattggcgatgaagcgaaagaacagttt
ctcgcccgtgaagggaagctgccggatgtcatcgttgcctgcgtcggcggcggcagcaac
gccatcggcatgttttacccgtttttgcaagatgacgtccgcctcgtcggcgtcgaggcg
gccggcaaagggatcgacactccgcaccatgcggcgaccatcacaaaagggacgaaaggg
gtcatacacggggcgatgacctacctgttgcaagacgagtacggacaaattctcgaaccg
tattcgatctcagccggccttgattaccccggcgtcggcccggaacatgcgtatttggcg
agcattggccgcgtccgctacgaaagcgcgaccgatgacgaggccgtcgctgcgtttcaa
ttgttggcgcaaacggaaggcatcattccggccatcgagtcggcccatgcggtggcgaaa
gccgtcgagctcgcacgcgagatgccgccggatgaaacggtgctcatttgcctgtccggc
cgcggagataaagatgtgcaaacgatgatgcgccatcttggtgcgagggaaggtgaagac
attgccactgtccgttaa

DBGET integrated database retrieval system