KEGG   Geobacillus sp. Y412MC61: GYMC61_0481Help
Entry
GYMC61_0481       CDS       T01101                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GYMC61_0481
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYMC61_0481
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GYMC61_0481
Enzymes [BR:gyc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GYMC61_0481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
484138..484953
Genome map
AA seq 271 aa AA seqDB search
MKTLPLSVNPPLFIPFIVAGDPAPDVTIDLALALEEAGADILELGVPYSDPLADGPTIQR
AAARALDGGMTLPKAIQLIGEMRKKGVNIPIILFTYYNPVLQLGEESFFALARENGADGV
LIPDLPFEESGPLRELGERFGLPLISLVAPTSKQRIERIASAAQGFLYCVSSLGVTGVRE
TLPETLGDFLREVKRHSRVPVAVGFGISAPEQVAMLKEVCDGVVVGSALVQKVEQLAPRL
QAPDEREAAVAEFSAYARSLAAPLREAYSSR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacattgccactgtccgttaatccgccgctatttatcccgtttatcgttgccggt
gatccggctcccgatgtgacgatcgatctcgccttggcgcttgaggaggccggcgctgac
atattagagcttggcgtgccgtactccgacccgctcgctgacggaccgacgattcaacgc
gccgccgcaagggcgcttgacgggggcatgacgctgccgaaagccattcagcttattggc
gagatgcgaaaaaaaggggtaaacattccgattattctctttacgtattacaatcctgtg
ttacaattaggagaagaatccttttttgctttagcgcgggaaaatggcgccgacggcgtg
ctcattcccgatttgccgtttgaggaaagcggtccgctccgcgaacttggcgaacggttt
ggtctcccgctcatttcgcttgttgcgccgacgtcgaagcagcggatcgagcggatcgct
tcggcggcgcaagggtttttgtattgcgtctcctcgctaggcgttacaggcgtgcgtgag
acgctgccggagacgctcggcgatttcctccgcgaagtgaagcggcatagccgcgtcccg
gtcgccgtcggctttggcatttcggcgccggagcaagtcgcgatgttgaaagaggtgtgc
gacggcgttgtcgtcggcagcgcgctcgtgcaaaaagtcgagcagctggctccgaggttg
caggcgccggacgaaagggaagcggccgtcgccgagttttctgcctacgcccgttcgctt
gccgcgccgcttcgagaagcctattcttcgcgctaa

DBGET integrated database retrieval system