KEGG   Geobacillus sp. Y412MC61: GYMC61_0558Help
Entry
GYMC61_0558       CDS       T01101                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GYMC61_0558
Enzymes [BR:gyc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     GYMC61_0558
Exosome [BR:gyc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GYMC61_0558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
564473..566515
Genome map
AA seq 680 aa AA seqDB search
MYGHHFASERMRSSLIAANPTDLEVYLFHEGRLYQSYELFGAHVIRDGGAVGTRFCVWAP
HAREVRLVGSFNDWNGANSPLTKVNDEGVWTIVVPENLEGHLYKYEIITPDGRVLLKADP
YAFYSELRPHTASIVYDLKGYEWNDSSWQRKKRRKRIYDQPMVIYELHFGSWKKKPDGRF
YTYREMADELIPYVLERGFTHIELLPLVEHPLDRSWGYQGTGYYSVTSRYGTPHDFMYFV
DRCHQAGLGVIIDWVPGHFCKDAHGLYMFDGAPTYEYANEKDRENYVWGTANFDLGKPEV
RSFLISNALFWLEYYHVDGFRVDAVANMLYWPNNDRLYENPYAVEFLRQLNEAVFAYDPN
VLMIAEDSTDWPRVTAPTYDGGLGFNYKWNMGWMNDMLKYMETPPHERKYAHNQVSFSLL
YAYSENFILPFSHDEVVHGKKSLLNKMPGSYEEKFAQLRLLYGYMMAHPGKKLLFMGSEF
AQFDEWKFEGELDWVLFDFELHRKMDEYVKQLIACYKRYKPFYELDHDPRGFEWIDVHNA
EQSIFSFVRRGKKDGDLLVIVCNFTNQAYDDYKVGVPLLAPYREVLNSDAAEFGGSGHVN
GKRLPAFSEPFHGKPYHVRMTIPPFGISILRPVQKRGERKQNEEEVHRHVIGRRARKPAS
LADEKHRETSRAVWGEVPDH
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
gtgtatggccatcattttgcttcggaaaggatgcgatccagcttgattgcggcgaatccg
acagatttagaagtgtatttgtttcatgaaggccgtttgtatcaaagttatgagctgttc
ggcgctcatgtcatccgcgacggcggagcggtcggcactcgcttttgcgtgtgggcgccc
catgcgcgggaagtccgtcttgtcggcagtttcaacgattggaatggggcgaattccccc
ctgacgaaggtgaacgacgaaggggtatggacgatcgttgttccagaaaacttggaaggg
catctctataaatatgagatcatcacaccggatggccgtgttctgttgaaagccgacccg
tacgccttttactccgaattgcgccctcataccgcctcgattgtctacgatttgaaagga
tacgagtggaatgattcatcttggcagcggaagaaacggcgaaagcggatttatgaccaa
ccgatggtcatttatgaacttcatttcggttcgtggaaaaagaaaccggacggccgcttt
tatacgtaccgtgagatggccgacgaactcattccgtacgtgctggagcgcggatttacg
cacattgagctgcttccgcttgtcgagcatccgctcgatcgttcgtggggatatcaaggg
accggctattattcggtgacaagccgctatggcacgccgcacgatttcatgtatttcgtc
gaccgctgccatcaagcggggcttggcgtcatcatcgactgggtgccggggcatttttgc
aaggacgcccacgggctgtacatgtttgacggcgcaccgacgtatgaatacgcgaatgaa
aaagaccgagaaaattacgtctgggggacggcgaattttgacttgggcaagccggaagtg
cgcagttttctgatctccaatgcgttgttttggctggagtattaccatgtggacgggttt
cgcgtcgatgcggtcgccaatatgctttattggccgaacaacgaccggctctatgaaaat
ccgtatgcggtcgagtttttgcgccagttgaatgaggcggtgtttgcctatgacccgaac
gtcttgatgatcgctgaagattcgaccgactggcctcgggtgaccgcgccgacgtacgat
ggcggccttgggtttaactacaagtggaacatgggctggatgaacgacatgctgaagtat
atggaaacgccgccgcatgagcggaaatacgcccataaccaagtcagtttttccctcctt
tatgcgtattcggaaaatttcattttgccattttcccatgatgaagttgtgcatggcaaa
aaatcgctgctcaataaaatgcctgggtcgtacgaagagaagttcgcccagctgcgccta
ttgtatggctacatgatggcccaccctgggaaaaagctgctgtttatgggcagtgagttt
gcccagtttgatgaatggaagtttgagggagagctcgactgggtgctgttcgattttgaa
ttgcaccggaaaatggacgaatatgtgaagcagctgatcgcctgctataaacggtataag
ccgttttacgagcttgatcatgatccgagggggtttgaatggattgacgttcataatgcc
gagcaaagcattttctcgttcgtccgccgcgggaaaaaagacggcgatctattggtaatt
gtttgcaatttcacaaatcaagcgtatgacgattacaaagtcggcgtgccgcttttggcg
ccgtaccgcgaagtgcttaacagcgatgcagcggagtttggcggttcgggacatgtcaac
gggaagcggcttcccgctttcagtgagccgtttcatggaaaaccgtaccatgtgcgcatg
acgattccgccgtttggcatttccattttgcggccagtgcaaaaacgaggggagagaaag
cagaatgaagaagaagtgcatcgccatgttattggccggcgggcaaggaagccggcttcg
ctcgctgacgaaaaacatcgcgaaaccagccgtgccgtttggggggaagtaccggatcat
tga

DBGET integrated database retrieval system