KEGG   Geobacillus sp. Y412MC61: GYMC61_0723Help
Entry
GYMC61_0723       CDS       T01101                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc00010  Glycolysis / Gluconeogenesis
gyc00620  Pyruvate metabolism
gyc00640  Propanoate metabolism
gyc00680  Methane metabolism
gyc01100  Metabolic pathways
gyc01110  Biosynthesis of secondary metabolites
gyc01120  Microbial metabolism in diverse environments
gyc01130  Biosynthesis of antibiotics
gyc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC61_0723
   00620 Pyruvate metabolism
    GYMC61_0723
   00640 Propanoate metabolism
    GYMC61_0723
  Energy metabolism
   00680 Methane metabolism
    GYMC61_0723
Enzymes [BR:gyc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GYMC61_0723
Lipid biosynthesis proteins [BR:gyc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GYMC61_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACX77394
JGI: GYMC61_0723
Position
713334..714926
Genome map
AA seq 530 aa AA seqDB search
MRREDLIAPERYNLTSEMERHAAAGPDRIALKWESEQGETKEITYGRLMARANQIGNAFL
SHGLEKGDKVLVMMPRLIETYEVYIGALKAGLVVIPSSEMLRTKDLQYRLVHSEAKAVVA
YAPYTDEFAPIDGIERLTKFVIGEPRDGWIPLEDAMAKESETLEAADTSRDDMAFLSYTS
GTTGNPKGVVHCHGWAYAHLRTAAKNWLCIEEGDLVWATAGPGWQKWIWSPFLSVLGSGA
TGFVYYGRFEPEKYLQLLEKYNINVLCCTPTEYRLMAKVPDIGRYHLSHLHSAVSAGEPL
NREVIDTFAKHFGVEVRDGYGQTENTLLVGVMKGMPIKPGSMGKPTPGNRVEIIDENGEP
CPPGQVGDIAVHIETPALFKYYYKDPERTAMQFRGDYYITGDKARKDEDGYFWFEGRGDD
IIISAGYTIGPFEVEDALVKHPAVKECAVVASPDEVRGHVVKAFVVLRDGVDKDDPSLIP
ALQEHVKQLTAPYKYPRKIEFVDDLPKTASGKIRRVELREREARLAGRSS
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgggaagacttgattgctcccgagcgctacaatttaacatcggaaatggaacgg
catgcggccgccggcccggatcggatcgcgttgaaatgggagagcgagcaaggcgaaacg
aaagagattacatacggccgcttgatggcgcgcgccaaccaaattggaaacgctttctta
tcgcatgggctcgaaaaaggcgataaagtgctcgtcatgatgccgcgcctcattgaaaca
tacgaagtgtatataggggcgctcaaagccgggcttgtcgtcatcccaagctcggagatg
ctgcggacaaaggatttgcaatatcggctcgtccatagcgaagcgaaagcggttgtcgct
tatgcgccgtatacggacgaatttgcgccgattgacggcatcgaacgtttgacgaagttc
gtcatcggggaaccccgggacggatggattccgcttgaagacgccatggccaaagagagc
gaaacgcttgaggcggcggatacctcgcgcgatgatatggcgtttttgtcgtacacatcc
ggcacgaccggcaatccgaaaggggtcgtccattgccatggttgggcgtatgcccacttg
cgcacggctgcgaaaaactggctgtgcattgaagaaggcgacctcgtttgggcgacggcc
ggaccgggatggcaaaaatggatttggagcccgtttttatcggtgctcggctcgggggcg
accggtttcgtctactacggccgctttgagccggaaaaatatttgcagctattggaaaaa
tacaacatcaatgtgctgtgctgcacgccgaccgagtatcgtttgatggcgaaagtgccg
gacatcggccgctatcatctatctcatttgcacagcgccgtgtccgccggagagccgctc
aaccgcgaagtgatcgacacgtttgccaagcatttcggcgtcgaagtgcgcgacggctac
ggccagacagaaaacacgctgcttgtcggcgtcatgaaaggaatgcccatcaagccgggt
tcgatggggaaaccgacgccaggcaaccgcgtcgaaattatcgatgaaaacggcgagccg
tgcccgcccggacaagtcggcgacatcgccgtccatatcgagacgccggcgctgtttaag
tattattacaaagatccggagcggacagcgatgcagttccgcggcgactactacattacg
ggagacaaagcgcgcaaagacgaagacggctatttctggtttgaaggccgcggggatgac
atcatcatcagcgccggctatacgatcggcccgtttgaagtcgaagacgcgcttgtcaag
cacccagccgtaaaagagtgcgccgtcgtcgccagtccggatgaagtgcgcggccatgtt
gtcaaagcgtttgtcgtgctgcgcgacggggtcgacaaagacgatccgtctctgattccg
gccctgcaagaacatgtgaaacagttgacggcgccgtacaaatacccgcgcaaaatcgag
tttgtcgacgatttgccgaaaacggcgtccggaaaaatccgccgcgtcgagctgcgcgag
cgggaagcccgccttgccggccggtcgtcgtaa

DBGET integrated database retrieval system