KEGG   Geobacillus sp. Y412MC61: GYMC61_0757Help
Entry
GYMC61_0757       CDS       T01101                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gyc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gyc00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gyc00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gyc00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:gyc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(749196..750854)
Genome map
AA seq 552 aa AA seqDB search
MANNLSPASLIQSFSWDQAFAHYDWDPRSRFNAAHEVCDRYAEDPNRIALFYENALGEQK
TITYRQLRDWSNQMANVFRKLGVKKGDRVCALMPKNPALVVYILAAWKVGAVYVPLFTAF
GPQAIEYRINHSEAKVLLTNKEQRAKLPPRDNMPTLEHIFVIDGPSHDQDQPFWETLSKE
STEHSIEETTVDDLLAIQYTSGSTGMPKGAMWPHNVLINIYPYMRYAIGLRDDDVFFGGA
DPGWAYGLIFCTFAPMAFGVPIVFYEGPFKPETCYSLMEKYRVTNFAYAPTAYRAMAAAG
ADVIRRYQLNVRAMSSAGEPLNPEVIRFFQEHVGVTIHDHYGLSETLMLIGNFNAAEMEI
RPGSMGWPLPGFDVALLDENGTPVADGEVGQIAFNTDSIPNVFKGYWKDPEKTAERLVGK
WFLTGDLATKDEDGYFWFQGRADDIISSAGYRIGPFEIESCLLEHPAVVEAAAVGKPDPV
KGEIVKAFVVLREGFAPSDELADELSLFVKTRLSKHEYPREVEFVAELPKTPSGKIQRFI
LRNQEREKSIKA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggccaacaatctatcacctgcctcactcattcaatcattttcttgggatcaggcattc
gctcattacgactgggatccccgcagccggttcaacgccgcccatgaagtatgcgaccgg
tatgccgaggatccgaaccgcattgcgctgttttatgaaaacgctttaggagagcaaaaa
acgatcacctatcgacaattgcgcgattggtccaaccaaatggcgaacgtgttccgcaag
ctgggcgtgaaaaaaggggatcgcgtctgcgcgctgatgccgaaaaacccggcccttgtc
gtctacattttggcggcttggaaagtcggcgccgtgtatgtgccgctctttaccgcgttt
ggcccacaggcgattgaatatcgcatcaaccattccgaggcgaaagtcctcttgacgaac
aaggaacagcgcgccaaactgccgccgcgggacaacatgccgacattggaacacattttt
gtcattgacggaccgtctcatgatcaagaccagccattttgggaaacgctttcgaaagag
tcgactgagcactcgatcgaagaaacgacggtcgacgatctgctcgcgattcagtatacg
tccggctcgaccgggatgccaaaaggcgccatgtggccgcataacgtgctcatcaacatt
tatccgtatatgcgctatgcgattggcctgcgcgatgacgatgtctttttcggcggggcg
gatccgggctgggcgtacgggctgatcttttgcaccttcgcgccgatggcctttggcgtg
ccgatcgtcttttacgaagggccgtttaagccggagacgtgctattccttgatggaaaaa
taccgggtgaccaatttcgcgtacgccccgaccgcgtaccgggcgatggcggcggccggc
gcggacgtcattcgccgctatcaactgaacgtgcgcgccatgagctcggccggcgagccg
ctcaatccggaagtcatccgctttttccaagagcacgtgggcgttacgatccatgaccat
tatggcttgtcggaaacgttgatgctgatcggaaacttcaacgccgccgagatggaaatc
cggcccggatcgatgggatggccgctgccgggctttgacgtggccctgctcgatgagaat
ggaaccccagtcgccgacggcgaagtcggacaaattgcctttaacaccgactcgatcccc
aacgtctttaaggggtattggaaagaccctgaaaaaaccgccgagcggctcgtcggcaag
tggtttttgaccggcgatttggcgacaaaagacgaagacgggtatttctggttccaagga
cgggcggacgacatcatctcgagcgccggctaccgcatcgggccgtttgaaatcgaaagc
tgcctccttgagcatccggctgtcgtcgaagcagccgccgtcgggaagccggatcccgtc
aaaggggaaatcgtcaaagcgtttgtcgtgctcagagaaggctttgcgccgtcggacgag
ctggccgacgagctgtccttgttcgtcaaaacgcgcttatccaagcatgaatacccgcgc
gaagtcgaatttgtcgccgaactgccgaaaacgccgagcggaaaaatccagcggttcatc
ctgcgcaatcaagaaagggaaaagtcaatcaaggcttaa

DBGET integrated database retrieval system