KEGG   Geobacillus sp. Y412MC61: GYMC61_0803Help
Entry
GYMC61_0803       CDS       T01101                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GYMC61_0803
Enzymes [BR:gyc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     GYMC61_0803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
796647..797735
Genome map
AA seq 362 aa AA seqDB search
MAKLDETLTMLKALTDAKGVPGNEREARDVMKTYIAPYADEVTTDGLGSLIAKKEGKSGG
PKVMIAGHLDEVGFMVTQIDDKGFIRFQTLGGWWSQVMLAQRVTIVTKKGDITGVIGSKP
PHILPPEARKKPVEIKDMFIDIGATSREEAMEWGVRPGDMIVPYFEFTVLNNEKMLLAKA
WDNRIGCAVAIDVLKQLKGVDHPNTVYGVGTVQEEVGLRGARTAAQFIQPDIAFAVDVGI
AGDTPGVSEKEAMGKLGAGPHIVLYDATMVSHRGLREFVIEVAEELNIPHHFDAMPGGGT
DAGAIHLTGIGVPSLTIAIPTRYIHSHAAILHRDDYENTVKLLVEVIKRLDADKVKQLTF
DE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagttggacgaaacgttgacgatgctgaaagcgctgaccgatgcgaaaggcgtc
ccgggcaatgagcgggaagcgcgcgatgtgatgaagacatacatagctccgtatgcggat
gaagtgacaacggatggcctcggcagcttgatcgccaaaaaagaagggaaatcgggcggg
ccgaaagtgatgatcgccggccatttggatgaagtcggctttatggtgacgcaaatcgac
gacaaaggattcatccgcttccaaacgcttggcggatggtggagccaagtaatgctcgcc
cagcgcgtgacgatcgtgacgaaaaaaggcgacatcaccggcgtcatcggttcgaagccg
ccgcacattctgccgccggaggcgcgcaaaaaaccggtggaaatcaaagatatgttcatc
gacatcggcgcgacaagccgcgaggaagcgatggagtggggcgtccgcccgggcgatatg
atcgtgccgtattttgaatttacggtattgaacaatgaaaaaatgctgctcgcgaaagca
tgggacaaccggatcggctgtgcggtcgccatcgatgtgctcaagcagctgaaaggcgtc
gaccatccaaacacggtatacggcgtcggcacggtgcaggaagaagtcggcttgcgcggc
gcgcgcacggccgcccaattcattcagccagatatcgcgtttgctgttgatgtcggcatt
gccggcgatacgccgggcgtgtcggaaaaagaagcgatgggcaaactcggcgccggcccg
cacatcgtcttgtacgacgcaacgatggtgtcgcaccgcggcttgcgcgaatttgtcatc
gaagtggcggaagagctgaacattccgcaccattttgacgccatgccaggcggcggtacg
gacgcgggagcgattcacttaaccggcatcggcgttccgtcgctcacgattgccatcccg
acgcgctacatccactcgcacgccgccattttgcaccgcgacgactacgaaaacacggtc
aagctgcttgttgaggtgatcaaacggcttgacgccgacaaagtgaaacaactgacgttt
gacgaataa

DBGET integrated database retrieval system