KEGG   Geobacillus sp. Y412MC61: GYMC61_0873Help
Entry
GYMC61_0873       CDS       T01101                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc00860  Porphyrin and chlorophyll metabolism
gyc01100  Metabolic pathways
gyc01110  Biosynthesis of secondary metabolites
gyc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GYMC61_0873
Enzymes [BR:gyc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GYMC61_0873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACX77540
JGI: GYMC61_0873
Position
869687..870454
Genome map
AA seq 255 aa AA seqDB search
MTHSALAGKTVLVTRGKEQAASFSAKLRAVGAVPVEIPLIAIRPAAPEEIASMVEQLGEY
RWLVFTSANAVRFFFPHVSLPRPLPEMAVVGRKTAAALAEHGLSPALVPDDYTAERLADL
LMPRVKQGDRVLFVKGNLARPTLPEALRNAGAAVDELTVYETKPDESGRERLLSLLRRRE
LDAVTLMSPSAVDSLVRLLDKEADVLLSGVAVACIGPVTKEAAERAGIPVHICPTDYTTD
GIIKAMEQYFSMEGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacacacagcgcgctcgccggcaaaacggtgcttgtgacgcgcggcaaagagcaggcc
gcgtcattttctgccaagctgcgcgctgtcggcgccgtgccggtcgagatcccgctcatt
gccatccgaccggcggcgccggaagaaatcgcttctatggttgagcagcttggcgaatac
cgttggctcgttttcacaagcgcgaacgccgtccgcttcttttttccacatgtttcgttg
ccgcggccgctgccggagatggctgtcgtcggccggaaaacagcggcggcgctcgccgag
catggtctttccccggcgctcgtgccggatgattacacggctgaacggctggctgacttg
ctcatgccgcgcgtcaaacaaggcgaccgggtgctgtttgtcaaaggcaatttggcgcgc
ccgaccttgcctgaggcgttgcgaaacgccggcgccgcggtcgacgagctcacggtgtat
gagaccaagcctgatgaaagcggccgggagcggttgttgtcgctgctgcgccggcgggag
cttgatgcggtcaccttgatgagcccgtcggcggttgacagccttgtccgccttctcgac
aaagaagcggatgtccttctttccggtgttgcggtcgcctgcatcggaccggtgacgaaa
gaagcggccgagcgggcgggcattccggtccatatttgtccgacggattacaccacggat
ggtataatcaaagcgatggaacaatatttttccatggagggacgatga

DBGET integrated database retrieval system