KEGG   Geobacillus sp. Y412MC61: GYMC61_0874Help
Entry
GYMC61_0874       CDS       T01101                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gyc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
870455..871429
Genome map
AA seq 324 aa AA seqDB search
MALSFDRHRRLRQTAAIRAMVRETHLRVEDLIYPLFVVEGSGIKREVPSMPGVYHLSLDR
LSEEVDDIAKLGIPAVMVFGVPNEKDEVGSQAYCETGIVQRAIRQIKAEHKDLVVIADTC
LCEYTSHGHCGVVENERVLNDPSLELLTKTAVSQAQAGADIIAPSNMMDGFVAAIRRGLD
EAGFEYVPIMSYAIKYASAFYGPFRDAADSAPQFGDRKTYQMDPANRLEAFREAESDVKE
GADFLMVKPALAYMDIIRDVKNRFPLPLVAYNVSGEYAMVKAAAQNGWIDEKPVVMEMLT
GMKRAGADLIITYFAKDVARWLAE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcactgtcatttgaccgccatcgccgtctgcggcaaacggctgcgattcgggcgatg
gtgcgtgagacgcatcttcgcgtcgaggatctcatttatccgctgtttgtggtcgaggga
agcggcattaagcgggaagtgccgtcgatgccaggggtttaccatttgtcgcttgaccgc
ttatccgaggaagtggacgacatcgccaagcttggcattcccgccgtcatggtgtttggc
gtgccgaatgaaaaagatgaagtcggttcgcaggcgtattgcgaaacagggattgttcag
cgggcgatccgccaaatcaaagccgaacacaaagatctagtcgtcattgcggatacgtgt
ttatgtgaatatacgagccacggccattgcggcgtcgtcgaaaacgagcgtgtgctgaac
gacccgtcgctcgagctcctcaccaaaacggcggtgagccaagcgcaagccggcgccgac
atcatcgcgccgtcgaacatgatggacggctttgtcgccgccattcgccgtgggcttgat
gaagcagggtttgagtatgtgccgatcatgtcgtatgcaatcaaatacgcttcggctttt
tacggcccgttccgtgatgccgccgacagcgcgccgcagtttggcgaccggaagacgtac
caaatggatccggccaaccgccttgaggcgttccgtgaagcggagtcggatgtcaaagaa
ggcgctgatttcttgatggtgaagccagcgcttgcctacatggatattatccgcgacgtc
aaaaaccgttttccgttgccgcttgtcgcctataacgtgagcggcgagtatgcgatggtc
aaagcggcggcgcaaaacggttggatcgatgagaagccggtcgtcatggaaatgttgaca
gggatgaaacgggcgggcgcggatttgatcattacgtattttgccaaagatgtcgcccgc
tggctggctgaatag

DBGET integrated database retrieval system