KEGG   Geobacillus sp. Y412MC61: GYMC61_0874Help
Entry
GYMC61_0874       CDS       T01101                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc00860  Porphyrin and chlorophyll metabolism
gyc01100  Metabolic pathways
gyc01110  Biosynthesis of secondary metabolites
gyc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GYMC61_0874
Enzymes [BR:gyc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     GYMC61_0874
Exosome [BR:gyc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GYMC61_0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACX77541
JGI: GYMC61_0874
Position
870455..871429
Genome map
AA seq 324 aa AA seqDB search
MALSFDRHRRLRQTAAIRAMVRETHLRVEDLIYPLFVVEGSGIKREVPSMPGVYHLSLDR
LSEEVDDIAKLGIPAVMVFGVPNEKDEVGSQAYCETGIVQRAIRQIKAEHKDLVVIADTC
LCEYTSHGHCGVVENERVLNDPSLELLTKTAVSQAQAGADIIAPSNMMDGFVAAIRRGLD
EAGFEYVPIMSYAIKYASAFYGPFRDAADSAPQFGDRKTYQMDPANRLEAFREAESDVKE
GADFLMVKPALAYMDIIRDVKNRFPLPLVAYNVSGEYAMVKAAAQNGWIDEKPVVMEMLT
GMKRAGADLIITYFAKDVARWLAE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcactgtcatttgaccgccatcgccgtctgcggcaaacggctgcgattcgggcgatg
gtgcgtgagacgcatcttcgcgtcgaggatctcatttatccgctgtttgtggtcgaggga
agcggcattaagcgggaagtgccgtcgatgccaggggtttaccatttgtcgcttgaccgc
ttatccgaggaagtggacgacatcgccaagcttggcattcccgccgtcatggtgtttggc
gtgccgaatgaaaaagatgaagtcggttcgcaggcgtattgcgaaacagggattgttcag
cgggcgatccgccaaatcaaagccgaacacaaagatctagtcgtcattgcggatacgtgt
ttatgtgaatatacgagccacggccattgcggcgtcgtcgaaaacgagcgtgtgctgaac
gacccgtcgctcgagctcctcaccaaaacggcggtgagccaagcgcaagccggcgccgac
atcatcgcgccgtcgaacatgatggacggctttgtcgccgccattcgccgtgggcttgat
gaagcagggtttgagtatgtgccgatcatgtcgtatgcaatcaaatacgcttcggctttt
tacggcccgttccgtgatgccgccgacagcgcgccgcagtttggcgaccggaagacgtac
caaatggatccggccaaccgccttgaggcgttccgtgaagcggagtcggatgtcaaagaa
ggcgctgatttcttgatggtgaagccagcgcttgcctacatggatattatccgcgacgtc
aaaaaccgttttccgttgccgcttgtcgcctataacgtgagcggcgagtatgcgatggtc
aaagcggcggcgcaaaacggttggatcgatgagaagccggtcgtcatggaaatgttgaca
gggatgaaacgggcgggcgcggatttgatcattacgtattttgccaaagatgtcgcccgc
tggctggctgaatag

DBGET integrated database retrieval system